ELFϐ4L4 (44 z z ||h ¤¤/usr/lib/ld.so.1 "#$%&'(),-2345679:=?@ACDEFGJLNOQRTVWXYZ[]^bcdghijmnprstuvy{|}~    !#$&()*+-/1234679;<=>?BDEFGHIJKNORTUWXY[]_`bcdefghijklmoprstvwxyz|}~     #$%&')+-.01234789;=?@ACDFGIJKMNPQRVWXZ\]`cdefghijlmquvwxyz{|}    !"#$%'(*+,./01356789<>@BFHJLMNOPSUWXYZ[\]_`bcefghijlnoqrsvwxyz{|~    !"%(+,-/034679:;=?@ABDEFIJKLMOPRTUY]^_`cdegjklmnpqstuwy{|}  !*+./018;<>BHIKMPSU\_`aefkloqwxz  "%',.058:@ACLMPQSVZ\^anqu{ !"(*,/56:<>BEHLOSTUY[^_abknoprst~  &)-24:;=?ACDEGIKQRTV^adkmptu}  #$&')*.1258<>CGHNQSVWXZ[\abfhiorvxz~ )X 9 2h FL ǰ [t ly zTd { ?X 2| P +8x @   @  H 0 I h ZW j L t,  p   'L 0 x,l  L  @ qd     -4(9  H=  Yp, h@ {| w r |,  8 0  @     4!H|5h;p LH0 d l, kl   , h p  48 (   P d   /5P L b x m _8x  4    P\   (pp  k8  X$ &0$ 7xd Kp YL l 0 | l 4h 0X P0  h@  G C P  & ,p 3 z:A Wj w~8{x  p x   a o  (d|  ޔ  Q w #   30:\@J  Z$h w  f    ,  * ]l 7     .p @ l P$^ft xD$  t @  ΀P =       < x8 #0H 9P H4 ^ d k\  pD 0\D ̘ l  e(  WH p ^ ( D @ Q  X¤ a  nQX8 w 4 |D  - D    \(  X  L % 7  D 8T R$ dDH v l X |8     k 8 ( ( ; ( I, OH d  oB _ X, 1` ,X X8 | |T |< o  x ,X| ?d J fx s f RPx H0   L .<  44  nP ' 3  A U\Z  e <0 }0h   |8 X       o4   ! X4\ 7 J-  ^ n  mP jPh   -x /   H -|  %|4 AK( N\ \ < jx y| ,  X`    4  l4  )x, "p 6 Iqd [ H f x v @ -  8   ?p l =P |( ` - <\ N <  `ь j,@ u `   ( ( L  ĔH X @  |  ڄ ,  >8 JT ` mt4 u\  !,D ( k p hp u $\  t, ! | - 0 <$ HP$  d r   0 p $8 t4x 3 ;L@     d   -  Dd T [kp oyd  0  CPt  T kP 0  _4  xX i< / $$ C v Vpx oǬP  (4 <  ܐL   w    8   k D "X3 "` NTX_ o m 5   Èmd = 38      ( %)8 ;  Q  i,p z | 3t     X| ?   /d    S<4 4   Bk( W j xp u  $     (  @ -   !    5Xt D V V!\ n H h| 4 k h  ̜     L  H ( !` /  8< O 4< \$ ky U0  d L   8 ?p 4  tD  *p -p2=k V  px 40  dD  *d   ` h Dl d V>\l  h  & |H 7 @ J48 Z  k  |  p h gL     ( @  T ? 7 ` DWthl4 ~ (   T t 8 lx  ,  \ #/ f 9 t BGj ]e x x x cl (@ fd  - 4 !L Ҭ   &\ ,; >, E [ | f, w,L `  P h ,  z  h ! 0` !  !&` !1i4< !E 0 !S  !a 0D !t(l ! 0L !(T !)`T ! ߠ !?  ! \ !<! | !i "d"DT $"1L "H""`"h o "| T "( "X| "  " i|L " ` " DD0 "D #x , #, #  #t( #9  #F  #\`< #nLj #@##ˠ  # , ## l #  #' #h $ , $ $ L $+t $< rX $SgH $m)$ $T$D, $  $($  $L $$ $ T $ `  %( %  %# g<, %:%K < %\ X %s  %, %%  % ] %P% %hp %5h & p  &L &' mDd &0 ^ &@   &H# &b &q.&Ӝx &  & &| & &p &D'J$ 'TD '+xh '@ x 'S}( 'cat 'tl ( ' '', 'T ' 'd '  (8 (p (&(/ (<  (L ` (^ h (m5  (M (. (  ( Qp ( | ( ( $ ( Ĩ )D ) )(  )7 3 )I"X$ )_)hQ< )pX, )D' )$ ) O )p )  )lH( )à!)( ** ( * o *0jL *@ \X *W <$ *lx *u *  *( * h *)l *  *, * l4 + ~h + jh +' x +2ˆ+6=Lh +DT +[ +iTt +z  +¼+ +< +G0 + + +8` +T +x ,,4,  ,-@ ,D Ud  ,W,\  ,l Ll ,|  ,, , ,<P ,(,  , ,J ,- m4 --!t "-0 }D -C , -W ޠ -d-v sX -- Wh - $ --\ - t -- X -(.kt ..&p .8$t .A.H.P  .a .t8 .4 . 1  . + .5| . .4< ..h / x /&/. \ /?T /U  /b$ /s>  // ( //( /<P / < /|/ D /4$ / l 00 0%L 05x  0J ) 0[4( 0nL 0J` 0` 0  0 4 8 0j@ 0 00\t 0\ 140 1  1  17 & 1I 1W1] 1q2,  1} 1 x0 1Ĝ 1` 1 W 1D 10p 1 1; 2 ̐ 2u 2-\d 262Bx2GGp 2Z2a7L 2v % 2}2@2 2k 2ΨD 2T2F| 2d 2L 2i( 3 8 3"  33 l4 ,3C0( 3W 3ad3i3rML 3 )Tt 3JP 3n| 3 3&* ބ 3 4\ 3p 3 $ 3 X 3 4 k  4 |  4+ 3`, 4<h 4N,4VX@ 4l T +14p 444 @ 4  4R$ 4? 4  4H 5 (  5 d4 5 50ͬ 5@h4, 5Vl0 5d  5u C$ 5ϐ  55kh 5 P 5 ', 5l 5(, 5|6 <( 6#\4x 636=l 6O  )à6ap 6rT 6 H8 66 6H 6 U 6  6r 6 ., 777 . 7'h 7=l7D  7U  7b ( 7k 7  7 7t 7xh 7 7 7 0L 7 *8 7 @ 88\ 8$m 8= | 8Lа 8T  8h 8z d 8>  8 H8 8lT 88p 8IPd 8H8w  9 8 9`  9)d 9?$( 9K l 9b 9p 9K 9v4 9/9t` 9\ 9 9p<X 9  :  : :9:@P :P  :[ \X :e:t  : B( : :fp :\@ :x :l :p\ \ : t ; d< ;! Xd ;3 L ;G8 ;[< ;p  ;  ;  ;$; x ;8 ;cp8 ; ;, < | <k( <4 ' 5  >>\ 4 >1 @ >DxH >Qjd< >dT >v >  >> m@T >P > > l  >! >?Px ?L ?&|  ?<CH ?E(?M ?aG ?p|| ?`? ?d ? ? xDd ?d @ ?0, ?  ? H  @ Hp @ 3L @4 YH @Egh0 @_M(  kH @r L @ p @8 @ vHX @ @%@  @@ h @  @8A  A( A 3(L A(  A8 AIAN 0 AX An Av ( A A  A  A "p Ai A P  AL A  B Bw8 B" B4 BLx B_PBq B@ B  BB  B3 BB ( B BlL  C C $X C!h C3TtCG8 CT n *ـCk | C{  C  CkP wC8 VلC(0 C CĐ DD&R"P D1 D@ , DR ` D\P H DnH D}  DDD DDD Dk D | DD  D( E A El@ E+DE3E= H EC"|  EVEb4T -HEv T E m04 E E8 Ed EE D  E, Evl Fx F%h F$ &P F3 L F?z FM` F^ k` FrFz \ F?@ F Z8 FFl|l F PX FF  F( Fhx G kx Gj0 G.( GBoHt GP | Gb x  GnìGv G g$ G G 2 8 G D GLT Gx G G|  H, H͸ H!10 H-  H=8 7`HQ Έ< H^ ` Hi l H{LH$h4 HHm H t H4 H? HxH<H\ HE I 0@ I"I/PI9d IS \| IfXIjlIr\ Ih0 Is,  I8h Il  I\ I< II Hh J 4 J8 J(Pl J7 ,$ JAPJH$ J] $ Jq | Jx J Ș J H J\J50x J  J 8  J m| K d K"tK.dK7(8 KL<KS \ K_ Ks 4 K^4X K @ Kn, K<p K8 KM 0 K< L8T Lt L+”L0L, LA LJX Lf8LoLy  LL (\ L0 L L_ Lvh L X< Ll MDt M oL M& [ M>_hD MMMUèTcl_ExprBooleantclStubsPtrTclFinalizeAuxDataTypeTabledeflateBoundatan2TclpFindSymbolTcl_FSRenameFileTcl_EofObjCmdTclGetLongTcl_JoinPathTcl_DumpActiveMemoryTcl_SetErrorCodeVATcl_MakeTcpClientChannelTcl_FlushTcl_SetStdChannelstrncpyTcl_InitHashTableTcl_FSFileAttrStringsTclpMasterUnlockTclX_SaveResultErrorInfoTcl_GlobalObjCmdTcl_WhileObjCmdTclInvokeTcl_GlobalEvalTcl_FcopyObjCmdTclSetStartupScriptPathswapgzeofrc4_inittclFreeObjListTclFinalizeLoadTcl_DStringGetResultgzdopenTcl_GetBooleanFromObjTcl_PanicVATcl_DeleteTracetclIntStubsTclpGetSecondsTcl_AttemptAllocTcl_ListObjCmdTcl_ExprBooleanObjsqrtTclServiceIdleTcl_UtfToExternalgetgrnamTcl_GetWideIntFromObjutimeTcl_UniCharIsDigitTclCompileLappendCmdTcl_WaitPidTcl_UniCharIsUpperTclpGetDatestrncmptclNativeFilesystemioctlTclRenameCommandTcl_GetByteArrayFromObjgzgetcTcl_ReapDetachedProcsTcl_UniCharIsSpaceTclCompileWhileCmdfwriteTclpCreateCommandChannelTcl_AsyncReadyTcl_SwitchObjCmdTcl_UniCharNcmpgetpwuidTclChannelEventScriptInvokerTclpGetHostByNameumaskTcl_EvalTokensStandardTclSockMinimumBuffersTclpGetCwdTcl_AppendUnicodeToObjgzgetsTclInitCompileEnvTcl_ConvertCountedElementSha1_InittclStringHashKeyTypestrftimeTcl_SplitObjCmdacceptTcl_CreateObjTraceTcl_ChannelInputProczcallocTcl_FSEqualPathsTclFinalizePreserveZvfs_SafeInitTclCleanupChildrenTcl_UpvarObjCmdTcl_ListObjAppendElementTcl_FSFileSystemInfoTcl_GetCwdTcl_GetAssocDataTcl_ReadTcl_ConcatObjTclCompileSetCmdTclGetDateSHA1UpdateTcl_EvalObjCmdTcl_FirstHashEntryinflatePrime_etextgetpidTcl_FSRemoveDirectorytclIntPlatStubsPtrTclXOSsystemgetuiddlsymTcl_SetIntObjgzreadTcl_SetLongObj.st_float_foreffTcl_DeleteEventsTcl_FlushObjCmdgzclose_finiTcl_ExitObjCmdTcl_SetDoubleObjTcl_GetGlobalNamespaceTclpFinalizeSocketsaccesstclIntPlatStubsTcl_ScanElementTclOpenFileChannelInsertProcTclIncrVar2Tcl_GetChannelNamesExTclUnsetEnvTclGetObjInterpProcTcl_GetObjResultTcl_SetNotifierTclGetNamespaceForQualNamesysconfTclFSMakePathFromNormalizedTcl_UniCharIsControlTclFreeCompileEnvTcl_AsyncDeletechownTcl_DbCkreallocTcl_ParseVarNamevsnprintfTclX_StrToUnsignedTcl_UniCharIsLowerlogTcl_UtfToLowerTclPreventAliasLoopTcl_AttemptDbCkallocTclpFindVariablegzputcTcl_UplevelObjCmdTclFSCwdPointerEqualsTcl_CreateExitHandlerTclGetOpenModeTcl_UnregisterChannelfseekstrlenTclFinalizeNotifierTclpFindExecutabledeflateSetHeaderTcl_GetAliasgzsetparamsTcl_RegExpGetInfoTclInitEncodingSubsystemTclDatestateTcl_GetUnicodeTcl_GetsObjCmdTcl_DeleteEventSourceTclNativeDupInternalRepTcl_WrongNumArgsgzputs_DYNAMIC_length_codelzmaInitTclpInitPlatformZlib_Init.ld_doubleTcl_SeekTclX_GetOpenChannelTclpMatchInDirectory_PROCEDURE_LINKAGE_TABLE_.st_floatTclpObjStatTclParseHexrealpathgetpgrpTcl_ExitTclInitSubsystemsTclpOpenFileTcl_BackslashTcl_PushCallFrameTcl_ListMathFuncsTclpObjCreateDirectoryTcl_LreplaceObjCmdTcl_FSMatchInDirectoryTclpUtfNcmp2Tcl_SetErrnomallocTcl_SocketObjCmdTcl_ChannelCloseProcTcl_AddInterpResolversTcl_GetCommandInfoTclParseWhiteSpaceTclpObjAccessabortTclCompileLlengthCmdTcl_ConcatTcl_NamespaceObjCmdTclCompileBreakCmdTclGetInterpProcTcl_ResetResultTclMatchIsTrivialTcl_InitNotifierTclCompileExprTclPtrSetVarTclResetFilesystemTcl_GetStringFromObjinflateInit2_TclInitByteCodeObjTcl_GetIntTcl_DeleteThreadExitHandlerTclX_UpShiftTcl_NewByteArrayObjTclFinalizeEncodingSubsystemTclCopyChannelTcl_RegExpMatchunameceilTcl_LinkVarTcl_AppendExportListTclDoGlobTcl_OutputBufferedTclFinalizeSynchronizationTclLsetListTcl_TraceVar2Tcl_DbIncrRefCountfreadTcl_UpVar2Tcl_GetNameOfExecutabletclIndexTypeTcl_FreeEncodingTclFinalizeAsyncendpwentTclX_GetOpenChannelObjrc4_from_anymodfTcl_ConvertElementTcl_SetVar2ExTcl_MutexLockTcl_UpdateLinkedVarTcl_GetUnicodeFromObjTclFSEnsureEpochOkTclPrintInstructionTcl_ExitThreadTclFinalizeEnvironmentTclFinalizeObjectsTclpInetNtoatclExecutableNameinflate_copyrightTclDatetmpTcl_CreateMathFuncTcl_GetVersiontclNativeExecutableNameTclSetCmdNameObjsockettclEmptyStringTcl_EvalObjvTcl_CdObjCmdTclCreateProcTclpGetClicksTcl_FSLoadFileTcl_ProcObjCmdTcl_GetCommandInfoFromTokenTcl_DStringStartSublist__huge_valTcl_UnsetVarTclObjInvokeGlobalTcl_MutexFinalizeTcl_DeleteExitHandlerrecvSHA1TransformTcl_CreateHashEntryTcl_CreateAliasObjTcl_SetBooleanObjTclpGmtimeTcl_RegExpRangeTclLooksLikeIntcfgetospeedTcl_TimeObjCmdTclSetPreInitScriptTclLookupSimpleVarTclResetShadowedCmdRefstclByteCodeTypeTcl_PkgRequireProcTcl_ReallocTclSetEnvTcl_DbNewWideIntObjTcl_PkgRequireTcl_NextHashEntryTclpGetHostByAddr.ld_floatTcl_FSLinkTclReErrorTcl_EvalObjExTclReleaseLiteralTcl_PreserverenameTcl_SetByteArrayLengthinflateGetHeadertclListTypeTcl_SetRecursionLimitTcl_PkgProvideExzcfreeTclLookupArrayElementTclpCreateProcessTcl_FSUtimeTclX_SetChannelOptionTclRememberConditionTclDatevalTclCompEvalObjgzflushTcl_DbDecrRefCountTcl_ChannelWatchProclocaltimeTcl_PwdObjCmdTclX_StrToOffsetInstallkit_InitTclFixupForwardJumpTclCompileForeachCmdTcl_SetVar2Tcl_UtfToTitletclInstructionTableTcl_GetMathFuncInfoCrapvfs_MountTcl_ScanCountedElementzErrorendgrent__ctyperc4_dup_repstrcatTcl_WriteRawTcl_InputBufferedTclTraceCommandObjCmdTclHideLiteralTcl_GetInterpPathTcl_GetLongFromObjTclObjLookupVarTcl_GetInterpResolversTcl_ParseBracesgetgidTclpNativeSplitPathTclDatepsTcl_SignalMsgTclpMasterLockdeflateCopyTclDatepvTclFreePackageInfoTclFSSetPathDetailsTcl_GetObjTypeTclCompileCmdWordTcl_AppendObjToObjTcl_RegExpExecObjTcl_IsChannelExistingTclUpdateReturnInfoTcl_CancelIdleCallTcl_UtfToExternalDStringTcl_DeleteInterpTcl_FinalizeTcl_DeleteNamespaceTcl_FSPathSeparatorTcl_GetVar2inflateSetDictionaryTcl_DbNewDoubleObjTcl_ReturnObjCmdTclSetByteCodeFromAnyTcl_GetThreadDataTclDate_TclDatesTclDeleteCompiledLocalVarsTclDate_TclDatevTcl_InitStubsdeflate_copyrighttclNsNameTypecoshTcl_AddErrorInfo__environ_lockTclFreeObjTcl_FindNamespaceVargethostbyaddr___errnoTclPrintObjectTcl_FinalizeNotifier.ld_llongTclpObjChdiracosTcl_FSGetPathTypeTcl_DbNewByteArrayObjTcl_FSConvertToPathTypeTcl_FSGetTranslatedPathTcl_ExecObjCmdStrDupTcl_InputBlockedTclpGetGrGidTcl_UniCharIsWordCharTcl_DbCkfreetclPlatStubsPtrTcl_CreateInterpdeflateResetTcl_GetCurrentThreadTclpGetDefaultStdChannelTcl_SplitListTcl_ChannelFlushProcTclRegisterLiteralinflateEndTclHandleCreateTcl_ClearChannelHandlersTcl_FSGetNormalizedPathTcl_EvalObjinflateSyncTcl_SetResultTclParseIntegertclEndOffsetTypeTclNeedSpaceTcl_GetStackedChannelTcl_FSGetInternalRepTcl_FSCopyFileTcl_GetCharLengthTclExpandJumpFixupArrayTclpObjGetCwdTcl_AllowExceptionshypotTcl_DbIsSharedTcl_ChannelSetOptionProcTcl_DeleteAssocDataTclCheckBadOctalTcl_AlertNotifierTclCompileLsetCmdTclGetIntForIndexTcl_UniCharLengzseekcompressTclCrossFilesystemCopyinflateInit_Tcl_IncrObjCmdgethostbynameTcl_NewUnicodeObjTclProcCleanupProcnl_langinfostrchrstrcasecmpget_crc_tableTcl_UniCharCaseMatchTcl_ValidateAllMemoryTcl_DeleteHashTableTclInThreadExit_$c1A.deflateInit2_sinhsetsockoptTcl_ChannelGetOptionProcTcl_RemoveInterpResolversTcl_LinsertObjCmdTcl_SetMainLoopTclDeleteVarsdeflateInit_execvpTclRegErrorTcl_RenameObjCmddlcloseTcl_SetCommandInfoFromTokenTcl_DoOneEventTclpTempFileNameTcl_ParseCommandinflateSyncPointTcl_RegExpMatchObjTcl_LsortObjCmdTclpThreadCreateTcl_InterpObjCmdTclFindElementTcl_GetDoubleTcl_GetEncodingTcl_GetPathTypeTclpSetInitialEncodingscfsetispeedTclX_AppendObjResultgzerrorTcl_FSFileAttrsGetTcl_InfoObjCmdTclFinalizeMemorySubsystemTclpReadlinktheFilesystemEpochtclByteArrayTypeTclX_GetOffsetFromObjTclInvokeObjectCommandTcl_CallWhenDeletedTcl_UtfNcmpTclExpandTokenArraygeteuidmktimeTclCompileListCmdTclpNativeToNormalizedZvfs_InitTcl_FreeParse_tr_tallygetpeernameTcl_Sleepgzprintf_endTclCompileContinueCmdstrpbrkTcl_UniCharIsPunctopen64Tcl_ExprLongTcl_MakeSafeTcl_SetServiceModeTclRegisterAuxDataType_exitmkfifoTcl_GetChannelNamesdeflateSetDictionaryTclCreateAuxData.st_llongTcl_RecordAndEvalftellTcl_FindNamespacestrcmpTcl_FSOpenFileChannelTcl_GetVarTcl_CreateThreadTcl_CreateSlaveTclpReallocTcl_FileEventObjCmdTclAccessInsertProcTclProcCompileProcTclDateerrflagTcl_FormatObjCmdCrapvfs_InittclWideIntTypeTclX_WrongArgsTclpObjLstatTcl_EvalExTcl_GetEncodingNameTcl_PidObjCmdTcl_GetVar2ExTcl_VariableObjCmdTclGetAuxDataTypeadler32Tcl_SourceObjCmdTclInitAuxDataTypeTableTcl_SetObjCmdTcl_FreeTcl_UtfBackslashtclProcBodyTypeinflateResetTcl_IsChannelSharedasinTcl_CreateThreadExitHandlerTclFinalizeIOSubsystem_get_exit_frame_monitorconnectTcl_ConditionNotifyTcl_UniCharToUpperTclX_InitCommandsTcl_LsearchObjCmdTclObjCommandCompleteTclpObjCopyFileTcl_ParseExprTcl_ScanObjCmdSHA1FinalmainTcl_VarEvalTclpObjLinkTclGetStartupScriptFileNameTclpGetPwNamTcl_DeleteFileHandlerTcl_CreateChannelTcl_InterpDeletedstrcpygetservbynameTcl_PackageObjCmdTclpCloseFilegettimeofdaycompressBoundTcl_DStringSetLengthMiniarc_InitTcl_DeleteCloseHandlercompress2rc4_cryptTclpLocaltimeTclAddLiteralObjTcl_CreateTimerHandlerTcl_SetDefaultEncodingDirTclTeardownNamespacewaitpidTcl_DeleteCommandFromTokenzlibVersionfmodTclCreateExceptRangeTcl_FSDataTclX_IdInitTcl_NewStringObjTclpUnloadFileTclX_JoinPathTcl_UniCharToTitleTcl_AppendStringsToObj__fsr_init_valueTcl_UtfToUniCharTclpFilesystemPathTypeTcl_UnsetObjCmdTcl_CreateCloseHandlergetsocknameTclInvokeStringCommandTcl_SetUnicodeObjfopenZvfs_MountTcl_ThreadAlertTcl_BadChannelOptionTclpSetVariablesTcl_PkgPresentEx_tr_initTcl_AppendToObjgzwriteTclInitNamespaceSubsystemTclSockGetPorttclArraySearchTypeTcl_FSGetTranslatedStringPathTclUniCharMatchTcl_ExprLongObjTclFindCompiledLocaltclForeachInfoTypeCrapvfs_SafeInitstrtoullTclCheckExecutionTracesTcl_FileObjCmdTcl_GetDoubleFromObjTcl_UniCharIsAlnumTclGetExtensionTcl_ServiceEventTcl_ChannelWideSeekProcTcl_ParseQuotedStringgetsockoptTcl_GetIndexFromObjStructTcl_OpenObjCmdTclX_DownShiftTcl_SignalIdTclObjInterpProcTclHandleReleaseTclSetLibraryPathgetgrgidrc4_free_repTcl_PrintDoubleTcl_GetAllocMutexTcl_RegExpExecTclTraceExecutionObjCmdTclCheckInterpTracesTcl_ImportTcl_UniCharToLowerTcl_OpenTcpServergzungetcTclCompileLindexCmdTcl_UntraceVarTcl_WaitForEvent.st_double_foreffTclX_IsNullObjTcl_JoinThreadTclTransferResultTclFreeJumpFixupArraytimezonelzmaEndTclCompileAppendCmdTcl_StringObjCmdTcl_IsSafeTcl_OpenTcpClient.st_doubleTcl_RecordAndEvalObjTcl_ChannelThreadActionProc_environTcl_FSJoinPathlistenzlibCompileFlagsTcl_ConditionWaitTcl_ChannelNameTclFinalizeCompilationTclpObjNormalizePathTcl_MainTclX_RestoreResultErrorInfoTcl_PkgProvideTcl_DetachChannelTcl_UtfToUpperTcl_UngetsTcl_DStringAppendElementTcl_FSNewNativePathTclRememberMutexTcl_FblockedObjCmdTclReExecTcl_UpVaratanTcl_DbCkallocTcl_GetCommandFullNameTcl_HashStatsTcl_SetAssocDataTclProcInterpProc__xargvTcl_ExprObjTcl_StatTcl_BreakObjCmdTcl_SetByteArrayObjTcl_UnstackChannelTcl_PosixErrorTcl_EvalFileTcl_FSCopyDirectorymkdirfdopenTcl_AsyncInvokeTclTraceVariableObjCmdTcl_DbNewStringObjsendTcl_ArrayObjCmdTclpGetUserHomeTclpStrftimelstat64Tcl_LoadObjCmdTcl_AlloctclXWrongArgsTclCompileVariableCmdTcl_GetChannelInstanceDataTcl_CatchObjCmdTclDatecharTcl_ConditionFinalizermdirTcl_DetachPidsTclpObjListVolumesTclChannelTransform_lib_versiontclObjHashKeyTypeTcl_DeleteTimerHandlersetuidTcl_GetUniCharTcl_VarTraceInfofcloseTcl_EventuallyFreeTclpLoadFile__xargcTcl_GetRangetclDefaultEncodingDirTclCompileExprCmdtclStringTypeTcl_NewBooleanObjTcl_EvalsscanfgetegidTclPrecTraceProcTcl_GetChannelTypeTcl_VwaitObjCmdTcl_DeleteCommanddeflateParamsTcl_AppendResultVATclGetOriginalCommandTcl_AllocStatBufTcl_ExprStringchmodTcl_IsChannelRegisteredTclFSNormalizeToUniquePathtolowerTcl_AppendObjCmdTclDeleteLiteralTableTclpGetPwUidTcl_PopCallFrameTcl_AttemptDbCkrealloctclIntTypeinflateCopyTcl_TraceObjCmdTcl_AccessTcl_GetRegExpFromObjclosedirTcl_UtfCharCompleteTclHandleFreeTclRegExpRangeUniCharTcl_ListObjReplaceCrapvfs_UnmountTcl_FconfigureObjCmdTcl_SetObjResultTcl_SetCommandInfoTcl_CreateChannelHandlerTclFileCopyCmdTcl_ReadRawTclpHasSocketsdeflateTcl_RegisterObjTypeTcl_SetListObjgethostnamerc4_string_repTcl_PutEnvTclInExitTcl_LogCommandInfoTcl_UtfToUniCharDStringTcl_RestoreResultTcl_GetMastermknodTcl_AddObjErrorInfoTcl_TellOldTcl_FSStatTclpMakeFileTclOpenFileChannelDeleteProcTcl_FindHashEntryTclUnixWaitForFileTcl_CreateCommandTcl_TellseekdirTcl_FindCommandTcl_ExposeCommandTcl_FSJoinToPathTcl_Getscfsetospeeddup2Tcl_UntraceCommandatexitTcl_GetChannelOptiongztell__iobselectTcl_LsetObjCmdTcl_AppendAllObjTypesTclFSMakePathRelativegetcwdTcl_TraceCommandTcl_VarEvalVAZvfs_UnmountTclInitObjSubsystemTcl_DStringEndSublistTcl_SourceRCFileTclGlobalInvokeTclCompileExprWordsTcl_Closeopendirgmtime_rTcl_EncodingObjCmdTcl_GetStringResultTclFileRenameCmdTcl_ForObjCmdTcl_ParseVarsignalTclPtrGetVarTclGlobgzrewindTcl_SetTimerTclX_RelativeExprTcl_ChannelClose2ProcTclpGetTimeTcl_SetErrorCodeTclHandlePreservedlerrorTcl_FSCreateDirectoryTcl_GetNamespaceResolversTclX_StrToIntreadlinkgetppidTclObjInvoke_tr_flush_blockTcl_ExprObjCmdTclDumpMemoryInfoTclFindProcTclExprFloatErrorTclpAllocTcl_SetMaxBlockTimeTclIsLocalScalarTcl_GetAliasObjTclpGetNativePathTypeTcl_SplitPathTclCompileScriptTcl_MakeFileChannel_starttclEmptyStringRepTcl_ChannelSeekProcTcl_CreateFileHandlergzdirectTcl_PutsObjCmdTclGetInstructionTable_GLOBAL_OFFSET_TABLE_TclProcDeleteProcTclInitNotifierinet_ntoaTcl_FSListVolumesTcl_RegExpCompileTcl_FSUnregisterTcl_CreateAliasTcl_AsyncMarktclDoubleTypeTclInterpReadyTcl_EvalTokensTcl_GetOpenFileTcl_GetChannelThreadTcl_ReadObjCmdTcl_AppendResultunlinkTclDatenerrsTcl_AppendElementTclLookupLiteralEntrystrstrTcl_RegsubObjCmdTclpInitLockz_errmsgTcl_ListObjAppendListTclpInitLibraryPathstrtoll.st_intInstallkit_ZlibCmdTcl_FSRegisterTcl_GlobalEvalObjdeflatePrimegzclearerrTclpFinalizePipestclBuiltinFuncTableTcl_FSGetCwdTcl_ExternalToUtfDStringTcl_ObjGetVar2.ld_intTclCompileStringCmdTcl_NewWideIntObjgzopenTcl_AttemptReallocTcl_DStringFreeTcl_SetSystemEncodingstrrchrTclX_GetUnsignedFromObjTcl_NotifyChannelchdirTcl_CloseObjCmdTcl_ServiceModeHookTclCompileCatchCmdTclGetEncodingFromObjTcl_ReleaseTclDeleteNamespaceVarsTclLindexFlatTcl_GetChannelModeTclDateparseTclpNativeJoinPathtclpFileAttrStringsTcl_SeekObjCmdTcl_OpenFileChannelTclGetEnvTcl_InvalidateStringRepTclObjUnsetVar2Tcl_ObjSetVar2__1cG__CrunMdo_exit_code6F_v_fflushTcl_CreateTrace_dist_codeTclIsProctclIntStubsPtrTclPtrIncrVardeflateEndTcl_CreateObjCommandTcl_ServiceAllTclFileAttrsCmdTclParseBackslashTclExpandCodeArrayTcl_ForeachObjCmdTcl_UtfNcasecmpTcl_AppendStringsToObjVATcl_LappendObjCmdTclGetAndDetachPidsTclInitLiteralTableTclGetLoadedPackagesTcl_AsyncCreateTcl_UnsetVar2Tcl_GetVariableFullNamepipeTcl_UniCharIsAlphaTclInitIOSubsystemTcl_GetServiceModeTclX_GetChannelOptionTcl_WriteCharsTclGuessPackageNameTcl_ChannelHandlerProcTcl_DiscardResultTclGetLibraryPathTcl_SubstObjTcl_TraceVarsetgidTcl_UniCharToUtfDStringTcl_ExternalToUtfTcl_DbNewBooleanObjTcl_NewLongObjTcl_DeleteChannelHandler_tr_stored_blockTcl_RegexpObjCmdTcl_CommandCompleteTclLindexListTcl_GetTimeTclCompileIfCmdTcl_GetsObjTcl_GetCurrentNamespaceTclpGmtime_unixTcl_FSChdirTcl_GetChannelHandleTcl_SetWideIntObjTcl_ErrorObjCmdTcl_DbNewListObjreaddir64Tcl_GetBooleanfcntlTcl_GetChannelNameTcl_MergeTcl_GetChannelBufferSizeTcl_SetChannelOptionTcl_FSFileAttrsSetTcl_GetSlaveTcl_ChannelVersionTclStatDeleteProcTcl_LlengthObjCmdTclpInitUnlockfprintfTclpObjCopyDirectoryTclFileDeleteCmdtclOriginalNotifierTclpDeleteFileTclInitJumpFixupArrayfloorTclDeleteExecEnvTclCompileTokensTcl_TranslateFileNameSHA1InitstrtoulTcl_DeleteHashEntryTcl_CaseObjCmdTcl_GetCommandFromObjexeclTcl_HideCommandTcl_FinalizeThreadTcl_ListObjIndexTcl_AfterObjCmdTcl_ErrnoIdTcl_JoinObjCmdTcl_UniCharToUtfinflate_fastTcl_ListObjGetElementsTcl_SetObjErrorCodeTcl_SetStringObjTcl_GetDefaultEncodingDirTclFileMakeDirsCmdinflate_tableTclNewProcBodyObjTcl_ReadCharsTcl_DoWhenIdleTclSetupEnvisattyTclpCheckStackSpaceexpTcl_UtfFindFirstTclCleanupByteCodememcmpTclpGetGrNamTclInterpInitTcl_EofTcl_DStringInitTcl_StackChannelbind_tr_alignTclFinalizeFilesystemsprintfTcl_SetNamespaceResolversTcl_IfObjCmdTcl_GetTopChannelTcl_GlobObjCmdinflateTcl_GetEncodingNamesTclpLocaltime_unixTcl_ChdirTcl_DStringAppendstrtodTcl_NewDoubleObjTcl_SpliceChannelTcl_DontCallWhenDeletedTcl_GetCommandNametclpFileAttrProcsTclInitCompiledLocalsTcl_FSDeleteFileTcl_DbNewLongObjatoiTclFinalizeLockTcl_ForgetImportstrtolTclVarTraceExistsTcl_PkgPresentTcl_ConvertToTypesymlinkTclpGetTimeZoneTclStatInsertProctclArrayHashKeyTypeTcl_FSAccessTclpObjRemoveDirectoryadler32_combineTcl_FSGetFileSystemForPathTcl_StringMatchTcl_ChannelOutputProcTclCreatePipelineTclGetStartupScriptPathTcl_GetIndexFromObjTclHideUnsafeCommandstclOneWordHashKeyTypelzmaDecodeTcl_ExprDoubleTcl_VarTraceInfo2TclpUtimeTclCompileIncrCmdTcl_GetChannelTclArraySettclBooleanTypetclPlatStubsdlopentzsetTcl_WriteTcl_ChannelGetHandleProcTcl_UnlinkVarmemcpyTcl_UntraceVar2TclLsetFlatTclpOpenFileChannelTclCompileForCmdlseek64getgroupscrc32TclEmitForwardJumpTclDatelvalTcl_ChannelBufferedTcl_UtfAtIndexTclRememberDataKeyTcl_GetStdChannelTclEvalObjvInternalTcl_OpenCommandChannelfputcTclpFreeTcl_PanicInstallkit_StartupTcl_NewListObjTcl_CreateNamespaceTcl_SaveResultTclRegAboutTcl_NewIntObjTclCreateExecEnvTclThreadDataKeyGetsetpgidTcl_UtfPrevTcl_InitMemoryTcl_SetObjLength_edataTcl_NewObjTcl_UniCharAtIndextclPlatformTclpDlopenTclCleanupCommandTcl_WriteObjTclThreadDataKeySetTcl_ChannelBlockModeProcTclCompileReturnCmdTcl_GetStringTcl_DStringResultTclpReaddir___ArgvTcl_CutChannelTclpObjRenameFileTcl_GetErrnodeflateTunecrc32_combineTcl_FSLstatTclX_StructOffsetTcl_InitCustomHashTableTcl_GetIntFromObjTcl_ExportTclNewFSPathObjTcl_SeekOldTcl_NumUtfCharsTcl_FSMountsChangedTclLookupVarTcl_SetVarTclpObjDeleteFilelog10Tcl_SubstObjCmdmemmoveTclAllocateFreeObjectsTcl_UniCharNcasecmpTclPrintSourceTcl_ClockObjCmdfabsforkTcl_LindexObjCmdTcl_CommandTraceInfoTcl_FreeResultTclDatedebugtcgetattrTclFSInternalToNormalizedTclCopyAndCollapsepowmkstempTclX_CreateObjCommandTcl_SetPanicProcTcl_FindExecutableTcl_ListObjLengthTcl_DbNewObjTcl_ExprDoubleObjTcl_RegisterChannelinet_addrTcl_UtfFindLastTcl_UtfNextTcl_PkgRequireExTclFileDirnameTclReFreememsetTclListObjSetElementTclCompileRegexpCmdTcl_UniCharIsPrintTclAccessDeleteProcTclReCompTclFormatInttcsetattrTcl_SetChannelBufferSizeTcl_UniCharIsGraphTclpCreateTempFileTclFinalizeThreadDataTcl_StringCaseMatchstrncasecmpgetpwnamTcl_InitObjHashTablegetenvTclGetFrameTcl_BackgroundErrorTcl_FSGetNativePathTcl_CreateEventSourceTcl_ErrnoMsgTcl_DuplicateObjTcl_BinaryObjCmdTclFinalizeExecutionTcl_ContinueObjCmdTcl_FSEvalFileTcl_StaticPackageTcl_IsStandardChanneltanhTcl_ConcatObjCmdtclStubsTclSetStartupScriptFileNamestrerrorsetlocaleTcl_Initlocaltime_rTclpCreatePipeTcl_UpdateObjCmdTcl_FSSplitPathTcl_ThreadQueueEventTcl_TellObjCmdTcl_GetHostNameTcl_CreateEncodingTcl_LrangeObjCmdTcl_MutexUnlockTcl_AttemptSetObjLengthTcl_QueueEventstrncat__cg92_usedlibc.so.1SUNW_1.1SUNWprivate_1.1libm.so.1libdl.so.1SISCD_2.3libsocket.so.1libnsl.so.1libresolv.so.2Ma0 ='Mk NqMtM ='MkM ztMM ztMMztM GQ{9'ôQ67l 0,8'D{P\htSCCD( 45@ELXdpP|-harl ]$0<HwTU` lxh;GF! ,8DqP\h7t3fz-3(R4@:L2XdIp| F`K$F ./$0z<HT>`lx4PIPJ" g,[8mDPi\h>tOW}20^~$(X4@LXd.p|*ˆ” @"bD"b"c, @'㠀 $+`-` `?-)#- =--% # @:7@:"# #@:@Á@)@:@: "      **`* @*  ""  "     + **      + **     **   㿘 "    //// 77㿘 "" "   ////    ////   7777 `" 2 2 *@2 *`2 *`*`2@2`""2 2 **2 **2`*2`*2`**222`22"㿘`" 6 6 6 6 .@.`.`.`'6@6`'㿘" &"6 6 6 6 ....6`6`6`....?6`6666?&`" 2 2 2 2 *@*`*`*`2@2`"""2 2 2 2 ****2`2`2`****2`2222"㿠@9@Z  @9`@/@O``@7@"@@9-M`2O@㿠@9o@9lN``/@ N```/@H8`Ha4@Y@!H !<@9YN @5  ? /@)K`/@'`.@#K`/"@! "@ `.@K.@2@*@ L /@  @ %`M`/2O * K OҀ /@ /. . 㿠N `/@@ub @`@ &@i @8O?`/"H/?㿈@ { @I?  " @w "  @$ @ b @Ob s`  @{{@[`@ 4`s` @Ԓ` `@Y$ p" " " " [`" 4r r r ( 8@2 $ `[`@`h`8s`[`2@" `@&Os`@`@! ?@ # @X p " " " % `8`h@ "@ "    @' @@YS(#\#@7b􀤠@ @\ @ HaD@͔? `@b@4k@  @@@ @4g2O   񀥠\@15H1"@4I萐@7H @@8@ @4G2O  7H@ @߉?`d@߃? `@ @X@l @  H+Hሖa@X@ * @ ?%H/H @(?#`@$???@Tx @P !#Ha@7” H'HḬ @=? @Iz\@ Ԧa<`" @⢘ @⸟@䀣 @  B @W " @ے?$ @ג?$  '` bb䀠@@W p" @Ò?'  8' ' w w w (' 4@1~ %  @7d 2`;H*0 @sh2 @T @O!a@7P @  @S `[h2 @S `@{HKa@  9H@O}!!@73 @ސH@7, @˒)" " @Tv2`' 0 *0  w @7 2` *0 j@' @7 2` *0 vw @7  *0 2`@w (O E"H' 0O耢Z2@O' O퀣 L"H' O퀣`2@  @6 *0 2` w 2 @S@5!@y OꀣG@6ӒO_ _ (@p2p `@d @O !7H@6 @i H!@6 2@V " " @S2`%0 *0 u@6 2` *0 j%@6 2` *0 v u @6 2`*0  u(O E"H%0O耧`Z2@O%O퀥L"H%O퀦2@  @6{ 2`*0 @u2 @S@N!Ha@6e O  +H@/a@۔?   @H3@ `@$@`@@W7@@W2@ \@ݹ?@1@mϐ#㿈;b@2R@?  @$@ @(?@2B`@  @@b@1@2>2O @1z @% @@&@@V@2'2O `@;@mc @ @Ð9Ԓ!L@ޖ  㿠@ܐ;b;b @V2H 㿠;@}{c谐"@  ` "@  @`@  @ 30?@ `@ @ 4 2p?  " 0㿠 4 "@ (@V{ (`@`@ 8 02@ 0@ p 0`@@GW;ya@@Vc 㿠 ,`@r b @n>^  4h "@  (`@  0@M @ϙ>`@,/& D@& H 8  <@^ @@ 0@M~ 4 4@^ <` 4#@v $$@ @n  2O>`@& @&  p  @^ @ 0@MS 4 4@^ ?  4!@ v %`%`@ߐ@v?`$`2O`x>^ > 4h 2@ (  @ 0@M+d> H4 & D+ 8@Z& H@^  @ 0@M 4^ :  4" v $$@ @ 2O<>2@ &@6>&??@,#&  p@'&  @^ @@ 0@L 4^ :  4 v $ $ @q@? $2O  >@> &?>^ ^  @ v @ v & "?㾰@"H ^   (^ 8`@  (^  (8@ @6`^ `>`?^  0@ 2 @P 2`*0 @ ?^ ?`^ " v !@v l& @>>`^  `&s`  8@$ x $ 'H$$$( 4$ 4- 4- @ 8^  02 @PÖ ^  ^ ^ v v v [` `<# 8d@s` d[`^  o# -& @)4^ >`@`0sh@w p^  02 @P ^  ^ ^ v  v v [h`!@;`d@sh dl[h^ o!@&^  㿠@?@  &` `" 㿠 `@&  `"@ @/~ 8 ?@&@8 @T 4`@ @I`  @"-Hb ?@ԞHb(?@Ξ㿠@? @3v  @-m&`^ 1 !m&`^ v`8&`H&`P&`@ 㿠`@ @ ?@2@ @D/H,@gϖ @3H 9Hb0"@@S@ @E @S"" 0" (0" ,^ r ^(r ^( ,w w `@ b`@@z y!@툒 (@ 8@Sq' 4  x$ H $ bH$ $$ ( 4$  4, 4*@p 8^@  p@SW' 4% 4%@l^' 4^2 @O @P/2`;*0 3H@w bP`1'`@2ƕ>  d@@і 㿐@= @9@#@)Ԧ!d@ݫ @S@b@.͒@ @`@9 @@Q` @~h@.Đ2O $4@D @$ @ 9H@["\@? @  "@,  @~B  8@.@  @b`@@ @ `@  @~"@.~2O  㿐@;b@.e@ @` @~@.d2O c\t0H㿠@R@9| "`@G.`@@ @`& Z (@; &  @'Hp@K?& @)H"x@B?& @+Hb@9?& -H@2?&  @& Z @;`& Z ;@&   㿠@ `@ ?㿘;7b@ 'Hb @1]  @0 / 1H"@@@J -@$@/ 2@3  @  @+@O/  `@Z7Ԕh@u  `@  / @m`@  / @c㿠@ ;HbȐ@0 @I㿘@ 'H@0 +b "@  % @31@"&b@He@ @;'b `"  㿠;b`@9H53/@g* b @+ -@+ %7H"@ 㿠 @3H /}bH @6 @;@;H9}c t 7H@6 5} @6   ` * *` @Q㿠 9@Q/!&` `@0!&` 㿠 @G! `" @В  @Q  & `@0@&@> 㿘 @GՒ.```.```.`` .` .``.`. . . .  O  @>`-&@@ &@ = "@@ "  = .H [@%  $O 㿠  @*  >`-&  :  + " ``@ @ `=(`%.``Oݶ. .  㿘@qb@{ @`;Hc(@ 㿘@@HC@? @/㿘@? @/ @Ő'17'7⬪" ` w  `/ /' '/'@ '5H@ @/  H-c`@@@J -@D @. 2@ݰ @-䀢 @ "H,,@O H @ː "@ @ -ԮO̫--@@ڃ  @_;Ԕa@z   Hch@/l@/~& @ Hcl @/  @@  @H@-?`$@S@PH㐐@ju @#H$@9@ې+Ԓ!Ȗaؐ@5  !Hc#@O@@B / @ @@O@$@@@@TH#@ֈ? @@@$@@B@H@t?  "@ @o  ?@$@@@Ԓ @֘   @ʮ';7bb'@ 'H @.t   I- @@@J `-@+ @, 2@ְ @@ . @H "@Ȱ  Oߓ--@ &@l3Ԕb@ه  &@ ;I `@.1  @@@- @(I <@ @?@`%@^I`D@@5I?%@7@9Ԓ4"D@E  H@im"@ @@%@Ґ  Ԑbd"x@+  I@IL`\@N1 @@8@O@W@?%@'I@|@Ղ? @?ݒ@%@@<@)I @n? `"@ @n @)@??%@!I@t d@T? 㿀;I@-`@- @ @ @ @- @@Ɋ9I @)?  Lh㼰 7 '"ܸ  O @ 'I< @-= @@;3  @Ԧ @gӒ8?@ @S37Ԓb☔@l  Q PX\'4','0@'(  O`$ @x֐$ @  O` 5- 1I  !l @CJ -@x ؖ@@+ 2@ $ @@_ @U. @ -`@T @J`  -`,@I @?`  -`@6` -`(@͐ @-`  -`@@Ԁ`@!` -` 4@  @`  -`0 @ @ `  -`@@`$O-  O`@ȭ#Ԕb@Ȗ  O`/@Ժ`@ @Ȝ%It@;?  @,"Ԁ d@?@ @I``/@!`4OI``@,Y@,d@, dd4Ɩ l0 t, |  ( I@, I@, @ @,  @,~X@  @,t @)@,n  P@,p\@ )@,c P;<  @ t 0|/ w :-@ +I 5/a@,P d ,1(@ 2/  @jf "@ @' @,1 d7@ @  Hv   @,        ma` `@a ` `` O  "O`02@R Ը bВ * #`I!@`f "H@ II!a @L$@<  Ȓ4O <  a+ @  <  -aO@=@|@ @v3I a@?㿠'D@+D @P" 8H"P  7  *  , >. - @+`  @"  `@#  *?2`j!* 2`* 2` * 2` *?O @ * 2`  $O* `@'?'@7ؒ @O!@@ /I @*ٔ @"#d@@8˔  @3Ю @ei8?@ @-%ԒԖ@   @t'4!I"80,Ժ(b@@vq0@e / ,@J -@],@). 2@ 0 @E(@;(@,/ @ @0  ,/  @ "@  @  @Ƒ'IH@0? ,/ 4@o @  ,/ @Ъ`"H 0O/  )Ԑ#@Չ  41I '4@GԐ2`җ*0 @ cP          4     t " $  RؒcP ܒ  ޒ   ܔ  ؔ 4Ԕ  Д  ̔ tȔ Ĕ             "p@^ @/I ;Itb@JÒ@Je  @J`'I 8wb'Ȕ ?'''#` '#\@ @'Ӗ'@{,`H}@1@ ͒''O@r@J@J!@;@G2`1I*0 >sh3 @FN 73 +'"#@ܒ d#<cH%I@Ԃ @ђ?@@j .@Ib@Ò?@Ͽ@+Ib@ϵ? @ [h:30  @F @e @ @`GlR''d3Ԑc @8 @J+@J)Htp'97; '#ئ O%@ -I @(ʔ @@@6 Ԓ @) ! @"Ь @cY8?@ @ِ;!ԒcP#`@   @'4 vL`0,@tc0 @ jL` ,I ‮c,,@J -@[,Ԛ(@@' 2@' 0@B(@8+@,,@ H- ,,@S H" ,,4@@c H ,,@Ѐ @  ,,  $0O, L`@Y9Ԕ#@t  L``/@Т` @ @H3Ic4@? I5IH@(n IؒP@(i ڒ@(e Ir4#T@(n ZXt@(i @EI2`\@(a `@~I c`@(I @='Id@(B Ih * #`@\ @I1Iwؔcl#|@H_ج@Kwؐ$Ĕ_؅=w_ج4Ow4w%Ih * #`@\ @Q#IIwؔcl|@Hݖ_ش@wؐ_ؕ> w˖_ش4Owwؐ@9If_ؔc @'ޗ30 I@   Ԫc#@Ҳ I@?@!@@ @Â_ؓ30 @n   ,X$ $8'7@'?,'Ԉ @ O"@ -I @'0 @z@w@5# В @'p! @̬ @a0?@ @?)3Ԓ#c@X  = x@', M($@rɐ(`@ M / J к $@6J -@q$@@%{ 2@x ( @X @N+@$/ @G @C  $/ @ @8  $/ @1 "@N  @( @Ӑ'J@r? $/ ,@ @ @  $/ @̀`@   $/   ; ( O/  M@§+Ԕc@–  M`/@̮@ @–%JD@5? 9J!J X@& JԒ``@& ֒@& Jnd,@& JVl`h@& @C2`| l@& @z1J  p@& @7J;J{`t@& x@[  @J J`| @G6@F-J@F' 8'?'  ''''#` #\@   @ush'F[h'2Hksh@sh@ [h@ @sh;: [h'' "Oshsh@ [h@ sh#: [h''`Osh@Ɛ@F@F%J@71Jb[h  @&30 '@J +ծ` )J@  @??@;!@ @[h30 @  sh@@ @[h耠G@shshВ: [h''l@3 c@в @F@F1#`@@  'J@%Q 5JԐ@`– @%J@13Ք (`8@І  -Jؖ@FF??@B% @=!J@%o @ #J`@? @%: 2 !J@B  @B2`*0 @ w@!@=!@%N @j_@-J $@%C 2@X @%bOC@ ?`30  @A8JD@%?? 3p  @AԖ 1!?`> #@x@Bn2`*0  wH _H'@:0p :@A  `O߸@BO2`*0 @=9!@$ O ;Ja,@i?@  R@$ @!@6㿠@ @;JaH;`ؖ @* 9J7J!`p@|5J3tbX @) /J-Jጔ@n+J)a  @) 'J%ἔ @)ܘ #J!aܔ! @)Ԙ JJb @PJJ"$@JJJ("<@DJ ~b@c @) J"P @) JJ`bh@. 㿠````(` * *`  , @ 4 ` ` @`, `4 @*`` -` )` `(`&`0` &`@ ,@+ @, +`4` ) 1 @` @` @ ``&`@-` *+ (`@-&` 50` @  @) @ 1 `,`4`@ `+@.` ,@ `@ `&`-@ *(+` 5(`0``@ `@@```@,&`4@ )`* /`@- 5 &` @@@(`0` 1 ````+ *)` ) @@`  `! @`"@&`@-5/`(`+` - 5 `#@`$`%@ `&&` @) 1 +@/`*`'(0@`(@ @&`$@- 5/``)`*`++ )`@ *&`(2@ @  (0`,`-`.`/+`++  -&`,5  @*2@`0`1`2`3+`-/` + &`03  @   @-5@`5`4`7/``6*  /`@ *&`42@@ @ + 3 @ `8`9+`-`:`;-* @&`82  @ *2 `<`=/`+`>`?/` &`<+`3` @   * 2 @3+&`*2  @ +`@3` + 3 &`+3@ *2@ 3 @+ @&`*2   +3+ 3@&` + 3  * 2@@  3`+`@!z&`#@  - 5 @  + 3  @+3  &` +`3`- 5  +3@@ &`  + 3   +`3` @@@+3 @&`  *2@ +  3 @ ,4 &`  @ *2*2 ,`4` &`$ @@  * 2  * 2 1`)` @ &`(@ *`2`@* 2 3+@ &`, +`3`@*`@2` *`2`@&`0@@ *2+`3` ) 1  &`4@@*2*@2 @(0@ &`8 @)`1`@*2@@ 7`/`@ @@ &`<@@ -5@)` 1`@3+ &` +`3`-57 @/ @&`@ /`7`+`3` @ @ +3@@&` *2@/`7`@@3`+`@@&` @@+3*@2  -@5@ &`@+`3`@+3@6.@@ &`@/ 7 @+`3`@@ - 5 @&`  .6@ /  7 @,@ 4@&` *2.@6@3`+`, &` 4 @#ܺ@@  @*2@  +`3`&`$/`7`@ @ @ @, 4 @ , 4  &`(/ 7 @  @@ @ @/`7`@+ 3 &`,.6@   / 7 @ + 3 @&`0+3   @ @  .6@*2@&`4+ 3 @@  @@@+3@3+&`8+`3`  + 3  3+&`<* 2 @  @ @+`@3`@ 5-@&`.6@  * @2  +3&`*`2`     .66.&`*@2@@   @ @@@*`2`@ *`2`@@&` +@ 3@@ @ @*2@ )`1`&`* 2 @   @ +3-5@&`+ 3 @@  @@@* 2 @-`5`&`+`3`@  @+ 3  - 5 &`*2@  @ +`3`@ ,4&` +3  @* 2 ,4@&`$* 2 @ @  @@+3@,`4`&`(+ 3 @  @ * @2 , 4 @&`,+`3`@ @ + @ 3 @ + 3 @ &`027`!֞  /`+`3`@  2*@  &`4 3+/`7`1 @) @ &`8@@ 2 *+31 ) &`< 2 **@2 1 )  @&`@ 3`+`*2@ 1 ) @  &` 2 * +`3` 1 @)   &` 3 +* 2 @ 2`*`@ &` @ 2@ *@+3@2`*`@@&`@ 2@ *@*@2@ 2`*` @&` 3`@+`*@2 2 @* @ @ &`@ 2`*`+`3`@ 2 * @  &` 3 +*`2` 2 *   &` @ 2 *+3@2 *  &`$@ 2 *@*@2. 6@ &`(+`@3`  *@ 2@4 ,@ &`,*`2`+` 3`, 4@ 1  &`0) @*`2` ,`4`@ &`4) * 21  @(`0` *@ 2(&`80- 5@ @@&`<   /` 7`@  ( 0@ @ & @ & & @ & & " H;j&.  0c" #" " `v" " " 㿠 . 7 & `?@6 & @`?@ &   @@$ @?G:@ @=@ O    @&@㿘 5 #3p? +  5   & !` *  0?5@*&( 6 @/ #3p? -&4 /``6 @ *"` 1p? ) &0@  O/@7Ր/ X4@/`   !@   aO  `u &+`@ 6 .`?&`+  2 -  ?&  )` 1-? ` &@. ` O6@-  @& \ @" <$L\㾘'  '     @w b#J-%b @@K 2@a 쀠"@@'쀦 @. @1 '!@!`@`'&O`@` %`+`'@ *"@ .@``%``@,%``(`$,` (`#* ̐Jh"@h@~  -@d@*R"@  dH[@ /5Ք`h@c  -@d@*7"@ d`H@@~ 7%Ք@H  -@ /-@@@2@а `H!@_ 9;Ք `Ȑ@)  -@H  --  O@-@5`#J@9b@\ @ @ !*  @`@ +!%@-%+`3 @ `2@7!̀@' Քa@ݘ  @ a*& + $ -@ H``@0@. ,  (`@2@h'@!@` ,p8;8/@`/@@ $@G 3?a)`  &>` -8:p8*з.@;հ @@@@#`ad#`p`#x`P`t#`` #t`D`L#`a#da,#\Ԙ#h#l#p#|####@j㿠;Jb;b @ 9 '!53@ \&@ &a"  㿠 @{  & \& `& d& h?& x㿠 "@ @ @@ X X d $ Pt 0<T,  ,(  4Tl "\x !@ȝ#\| O'@Ѐ@9x!Ѐ8@?(ƀ#p#l#t#x##`#d#h#|###l#h#p#`#d#t#x#|###p#l#x#'#t#`#d#h#|###p#h#l#x##t#`#d#|## #`#d#h#l#p#t#x#|##@#p#l#h#t#x##d#`#|##lp#t#p#l#x##`#d#h#|## #p#l#t#x##h#`#d#|## #p#l#x#t#`#d#h#|###Z #p#h#l#x##`#d#t#|##Q #p#l#x#| '#t#`#d#h###'|) #p#h#l##`#d#t#x#|#Y #p#l#x##h#`#d#t#|##w-`#p#l#x#`#d#h#t#|###p#p#x#t##`#d#h#l#|##up#x#p#l##t#`#d#h#|##| #p#l#t#x##d#`#h#|#p#p#l#t##`#d#h#x#|###p#l#t#x###d#`#h#|#,p#p#l#t#x##h#`#d#|###l#p#t#x##h#`#d#|##]#p#l#t##x#`#d#h#|##]#p#l#t#x##h#`#d#|##O#x#p#l#t##h#`#d#|##`#p#l#t#x#`#d#h#|###K#p#l#t#x##`#d#h#|#p#p#l#t#x##`#d#h#|##p#p#l#t#x##`#d#h#|##p#p#l#t#x##`#d#h#|##p@Q.p/ l#'#p  '#l'@` '/ @9h$ `'#h/``'x'(@@  $@ @2H'쁀 s@R#@' bD@*(@ -`@W h"@.@<@t(`%(  `nl'6@'#̀` @'#'#̀@ & @x  #|, ,@'6 P@ @ (" :  )p020@ 5  #@;`' '+0000& #@ 5 #@G''np  t- '̆''| p @.p/ @l! '#p '#l'@C@{,@'6 P@ @ (" :  )p01p0@5  #@;`' '& +002p0#@#@5 @''p`@.p/ l '#p` `'#l'&O·,F' 'xhx&OŇ,='@:,|6 = -  `' #|-` @@ 'R@ @ ( '" : )p03p05 @;  '*0''0p0#5 &@@|/''zp|/'@'/ '〤  'xx@  t*` !''|] ` d'''؀`#`#d@  t '#&d''''|D @ (t( !''|6  t+@!''|, @Sh"@? `&H #'Ȁ @$&@ @x@ /+@  $ @ 2H'쁀 pR 'h$  `'#h/``'' 'xx@d#d t) @ ''| @`d`'d#`#d''ض't *h' '''| @t *` # c`' ' '''x&@ < @)@t.,@ " #^' ''@'''H @5''$6'x  &H #''x^p'xp`@.p/ l&`'#p` `'#l'@'6, @@'' :G''pt, # 'Ԫ D' ''w- @ '@6 T@ @ (!@ #9 (p030@ 5 @ '+&:` '*0'@100"@5   #@''p@.p/ l#'#p  '#l ' ` 'xɲx`'@G'''Ԁ@3h8@Ű?h'Ј@#h' @#&@ @x@ @/.@  $ @@ 2H'쁀 p@V @ '/``$ '''Oဤ k  'xx?'x 'xx'xp @}pl '#p #l'`4@?}'8;`|H 0p @:`;`% +* "9#@ `8`J 1p #9 +  @- `#- '')@ '6- @t @t@@ "@K?'#t' @% )`$t@ 1!`t)`!`5O)`  -`'''p@Npl`" '`#p  '#l)@'G'@x`@x@ѐ @̐"@?'#x'x$-@  'p@ pl/  '#p '#l'G'h t +`'( ''|"  'xԲx 'xвx' '| @ ('Њ  )` @''Q `' '| 6 R@ ("= *02005 ' @9 ''+0 20&! 5 @' @'p @.p/ l# '#p '#l''|c 'xx@  'Э( -`@ ''   'вb'  '' #' #@ ' ,'"'5+`@'6 S@ @ (!  #<(p0300 5 @:' '*p0& 30" 5 @@`# @''p @.p/ l"'#p  '#l '  'xx'G' +'$ '' 'xx 'xx\ @O$@ ? 㿘@ @@% @~:'@\+ @̅@;Jbؐ@” @l 㿠왐 @;J 9b#@g  㿠f @;J 9b!̐@g 7J5 @ 3J/c ጐ @w @@ @p@Đ 㿘'֐ @eJ$;@}? @" bǖ @T/J-J+J8<cH@f )J'J%J#`dp#J@\ J!J㘒c#@T JJJc#cĐ@K J J Jܔc#@B @  @#7@5K3K@E` @5? @n "@ @  "@   "@ ;@gb́  㿠`;'b;bl@g $d @;7cP  O%@ !K p @Y /K@ "@ `@@  @V"@ @'ǒغ@7,P?'?c @  @_k '@_f@ @  @a '@a@  @ ?'؈a؇> H0 ' 8`'> %'@'@'~ 'K 8'w #` #\'@k @Q@n  @ @qܐ@GE?@qՐ@@G  K6H'''w`'''@'T@'A '@ 8G@ @ @}"H @v@@ @'1 ܟ.''@@,  @'! 㿠;K`;`h @ 9K7K @v 㿘@ ';?!@Аb%>@> `~=P" <` " ; " " `" @" 㿠@@0 @`@/@O``@7@"@@z-M`2O@㿠@i@fN``/@ N```/@K`Ka@/@!K !@SN @5  ? /@)K`/@'`.@#K`/"@! "@ `.@K.@2@*@ L /@  @ %`M`/2O * K OҀ /@ /. . 㿠N `/@@K\ @|`@ &@{i @O?`/"H/?㿐@{ { @C?  " @M " `?@$`@{,`@I  @Qw@{@ @ 1 ? @ZҒ` `@/" `" " " " " " " " " " $ (@ `@$ `X`(@"  O@`@! @Z # @. ` " " " % `(`X@ "@ "    @' @z@/S#\@8@z#` `" l@`@א @K@ǔ? `@ #4@ d  @  @@z@Z@ ^2O   `\ @/ +c4@ @ @1K @{ @ @ @ =2O  1K@{   @~?u`!,@x?  m`5KH@B @     ^`#K%KaL\@.@     K??!K@*x 2`*0 @ sh@&  !d@  @  Kl @:?   +[h9;sh\ @y բ" @ @z#dc4@ @[h7@-  " @ؒ?%@Ԓ?% % b,@@- ` " @?%``(%`%` %`%`%`%`%` %`$@y % ()`'+ #@- " 8`2 @) `@K .#d ad@% @ : @.@ *+ * @ `@(@ @%Ɩ @zJ `/@@`@" " / @) I'`+`**@ '` / +`* @ '`)`+(@ '` @8`(@ 5>ܒ" " / .`@ '`*() @ @'` .`**  @ '`/ .`+`@ '`>1p @)L OZ  +K@;a@?    @j`@ ` @& `@y`@ `?@$`@y@ @-c @ @-^ @ @ 5@D`\@?㿈;c4@~@?  @yP@ @(?@n`@  @@x@@j2O @ @% @x@&@x@-@S2O `@;@Ca` @ @9Ւ"@   㿠@y;c(;b @,2H 㿠;@Sa`"@  ` "@  @`@   @ 30?@ `@ @ $ 2p?  " 㿠  "@ @,@?  `@@;`X@9@, 㿠 8H 2@  @2 & ,& 0@29` @ @ @#   $& '`'`@i @ ``2O` 2@ &`@&?? @#  '@& @& & "?8@"H    @   @@2@   @?  @9 2 @'֖ 2`*0 8`@?  " & "@& @@% @ '  x'  'K' $ᰐ' (  '  - - @} 8  <2 @'    & & & @ &@d@ dH O&@ 㿠͐@?@  &` `" 㿠 `@&  `"@ @ ( ?@&@wN @+ $`@ @w_`  @CKa?@Ka?@㿠@? @   @-m&`1 !m&`?`v`8&`H&`P&`@ 㿠`@ u@ ?k2@ @wY`K!@> @K KaĖԐ@+ @ @#  +K? 2 @& ̐@"x ̒a@ . @ @ @;Ka@?@ @* X" X@Ĕԯ(`@@'`@*{'``  &  x & K& $& (`& `*`) @y 8'`/ --@'`'Kޟ, *'` + @@ @'`'`. (@@=`2 @&} @'#2`5*0 @'`&@ > 7ܒ@Ɩ 㿐@= @9@u#@v)զ#@ @*@vc4@’@ @v`@. @@vF` @U]@2O $4@D @v @ 9K@P"@? @  "@,  @U7  (@@  @vW`q@@ @ `@ @U@s2O  㿐@u;c4@Z@ @u` @T@Y2O aD\tȝ㿠@v@9 "耦`@%.`@@ @u& @x & @x &  @u& @x & @x &   㿠@ `@ ?㿠@ ;Kb$ @q @  Z@u@ R@uM㿠@ ;Kb<@N @u9㿠;cl`@9K53`/@> b @ 4-@ %l7K"HP@1 㿠 @ @@;K9bT , 7K@  5` @   㿘@/ @ȁ@@ue @@ `?&`4@ @tՐ @@xB`&``@ @tǐՂc$a   @d㿘@Q9"  N ` @@+` N ` @ N  ` 2O `-@  @6 `+@  @,@&@@ @ `"@O`@ %  "@ 3``'O`@  O` &  㿘@" /O`ౚ @`@) `O`  @ O``@2O`@ܔ@ @Ѷ "@O``@ `! `"@ 3``'O``@ ` O` &  㿘@9"  N ` @@+` N ` @ N  ` 2O `-@  @ `+@  @@@@ @u `"@O`@ %  "@ 3``'O`@  O` &  㿠2@N`@@'{ N``@`7 @ᲀ@` @/`>.  N``2O @. 㿠2@N`@ݐ@'W N``@7`Პ ` @` @/`>.  N``O `. 㿘@w@ @@s ;ՔcT;Ֆcx@R  &  㿘@v"@ & h;K@rѐbp` @ @vҔ2 3?@s J I#|@  Kbt@ɔ "@O`O`J @6Kx@ @0O`e؟5ؚ 'K3p?`&@h|@]" @ @`@&@`@k@q@@@'I`@&@b@  &㿘@@ @@ 75Ւㄖ @ @H 9;Ֆ#c@  㿘@s0 @@ @@ 35ՖcԐ @ @H 7;Ֆc@~  㿠;N `$O`$@ Kb@Ր2@N NN @ K"@Ȑ2@N  N N @@ !K"@2@N NN @@ 'K@2@N NN @ -K@2@N  N N @ 5K@@7K 7K@z⬁ 㿠 @ @ H3ր "@5;K @ "H9;Kց`P`X\7ց` h@zbȁ ȸ,@Ŵ,@ H -ր"H /n;K+֔`t@$P@@Ɗ @L"H,"@+,L J K @ K@0b䀐2@,? #J L`@ %K@#쀐2@,2 +J M`@1-K@@-;K% M {"H@R @  * @K }@* /` ,J``01 0?`@3& ;K@z b `@ `H%ր`"H#-?G7K#ր`"@;"H=7K`4Ԁ"@/H"H.7K`%`"=  @@/$/5K@@@O@ 9֔ @%^7K@y 㿘' '@㿘@b@q;b(@x N @3֒`@o  㿠'H'L'P'T'X@E `@  @ @H`@ L?@*  `O㿘;b,`@ +K@poc8)'K%",%@pi@$0 @3  2p?b,@  @Pj 2?@qB 3p? 㿐!@`@p;' b @{ '@3@pY'b$ @o @'@pN'@uv'@N   " 㿐 @On@ `@  @u H;'K;@xHb$ 9`@I  " @B @j!&!`? @&`@p[P@]/@]Ґ4@= /4@7 `@,@,2@ N`@ɘN``t@N`c@ N`l@N` xH`@ ;Kch@t@ 㿘 @F `@ @-8`@;b8b8 @@ &@ O@㿐@d@,@ @?@ 9K#p@5;֐a@6 @{ 㿠@y@ `@ ;֒a@% @j @s `@@a 㿐@,5K@t@ @  @ݔ?@P ;֔a(@ @G 㿠@E@Ґ`@9֒!<@  @r` 㿘`@ aPV@o  @o ֲO`Jd @ Kx@Đ@!!L!lO`@@#Kc@@ @t~"@ \)O`M!t@ +Kc@2@33Na|O`@7K@@ @tX"@ q9֐!Ȗ??  㿠`@!@o J J܀@ @Kc@^@#@ #LaN@%K@M@ +@@r6@ +MaN@ -K@8@5@5NN@9K#@'@ ;@|@r@Đ ;֘b@??  㿠`@bD`2@ @]@q@ @o J Kbd @K@@`@!"le@B@q@ 'O`L|@@:)K#@Ґ@4`2@  @.@q@m @n `@/MJ @@3K@cȀ@@ `@ ;7֒bC  @@  b9֐#?Д?.  㿐@t`@cbX @@ #X@!* !"X@@@\@;@u @"h @9@ @qT@M; `$O`+ ?@n"@  `@@M"$O`7K5֒@:@< @ @@@"' #㾠`@;c@!6@ /@;V  @`?@ `c$㿠`@`2@@b@n @7@ ;9֒c0#8x  @P H @;k @ @ 㿘`@`2@ @+@p@[ @p@ @@  @:8  㿠`@`2@@x@m @ڶ@ ;9֒cL#T  @ H @: @ @ 㿘`@X`2@ @:@̺@pg @p@ @@  @:Ք  㿠@9#h@mO J Kx @ x'K@ @@LL`@ -K@@LL`@ 7K@@LL`@@ Kc@@ bL$L`@ K#@@ TL0L`@@ L`@ݐ@L8L` @ L @А@ҁL@L`@ 'L@Ð@LHL`@ -L@@LPL`@ 7L @@C;#\`T|4 L`(bP  @˞㿐?''@"@ @9Ȑה``  @ @ @9הx q@?@ @9הࠐ bHe@@` @@" @9ה`Đޖ @˔ C@@Ô 6@ @9wה ǖ  @< `& `@%+?c@@53ז`@ -@   `@9ג!$  @@ @}L L א,`4 @z @'@ @֐ 㿘@#b+b@}@= @B!" !" @k " &!  " @&  & & & @ْ & X & \& `& d& h& l& p& t& x& |& @˒ & & & @Og & & & & & &!&!&! &!&!&!@j&!&! " @A.!&! & @Y  @& !b=@s @ &!#4& `@N 8#b#~$ T ? ``@ ``@` @@s `````@#@Đ"  " " " ` " ``2@" " " `" ``2@" " " " $" " $" (" ," 0" 4%` ``2O` c|  @#' | ``` @  L`"@ 1b `$$` ``2O` !>@s1` ! &! @A@7O@-)4b3)baDbК 3b;b@= @of ~~)b-b@X ?'b7b @  ,!b;b@ ?0= t  q@ @А bb ?@D4H @x@۔ 㿠@ @/aԬ@` @9# @@z `2O `@;?aP`@/bL@n @  @k `% ! @ @Ր 8&! @} !  0Ā$`$`" 㿐! @@@  @ @@ @|2O @5@㿘! @ @ 8&! @I !  0@ @` " @ " " &` 㿠! @ ,@@`  @ @@}㿠! 2@ , 2@  "@  & ! ` 2p?!@`"Ȋ@ `"!@ @\㿐@ Xbl`@@ b`@q!@b?@qݐ @v @X0   @@ِ@  @@ܐ2O @@ @Ɛ@  @@ɐ2O @l! @#&! @@ @@@m@2O @M@c! 2O&! @W @ΐ!&  @% @h! p&!䀢 "@ t@L& p t "@ x@E& t x @@>& x@!`@@,!`O! "@!@{!@&@h! &!@  @@ 2O @L@㿘!`@ @/bcȠ@@@@7))Pa@   @\"2@  @"@@ː) )!@  `@ @H 8@ &`0@ @1)')@!Ԥ@Ę   "@ & @2 & & & %`  `@ & 㿘!`@ @/baЬ̤@@("@ @w9))"  @   2@ ,  @ 2@ @` ))bHd@w  `  @ `#)@Mbh@i  @@=1)-)"@T  ` "@'`@'`'`&` `@  &  㿀! @ @b`Ц@@@#\#` @Z(`"@R `@`` ''```@쀢 "@`  `0"`0@  `쀢@@` @b 8'` % " `" " " " " " " " " $" (" ," 0@" 4& 0` &``@ `%``2O`@[㿀! @ @bD@bԒ@E@#\#` @Y(`"@_ `@`` ''```쀠`@  `  2@ 0& & & $& (& 0@`@쀢@@k` @ 8&` # " |T" " " " " " " " " $" (" ," 0@" 4& 0 &@ %2O@[mP @@- @  @g:%`@$O.$  @@P@c@ @@= @x. / + b@@ @`@@fo`%'``'`'`@'`  `'`'`  @S'`@֔`*`'` '`$``$O  Ā@ `@@ @@f@ @   " @@fO$O@@㾰@a@ @Y @+)bԀ@N@ @f#\?  @ @e 3  " @7a @N@#\#` @XS(`@f`@c```@O`@" &&@Zf@@@&&V`@`@? @@bؒ@ @?&@f @h@X@ `& @ & @ #`@%)7)@, @ `@Ԑ) )c @ `@` `@'`` @ "@`` @ 1 ""@ @ '`' 㿠 @Xߖ @@ @` #``#` ` @ #`?#``#``#``#`$`#`( 㿠 @X @@ @ !< 0 0p?"` "` "` "`  "` $"` ("` "`  @ "@b` @b (@@    ܚ@ 㿠@+`@@`@@? `@@1b?@ `@`( @?@?@㿠 @X) @?@㿠`,@@o`&` ` `4&`, &` @ @: `4 @   @" @2O &`4`"@`$ & `$"@`0`(`0 @   Ő`2O ` "@&`@0&`@ 㿐@;`,a@`@ @@!-H`` &`,/ @  &`!쀍&!''@@'@s`4`@ C``' ` @6'`,@&`, 2@ @c `$ '``'`'`'`'` '`@`@d\`%```@`,)&`,`@%`@:`2O``@`?@'`` @@` @`@@ '`$ ``,&`&`,&!@T  @" @㿘 P @ @n $%  2H?   `&@   &  ?@? ?& " 4H `@T" `@2 %8`.`@&@&@+ ` @% ll` $``$$O$`@+$$` `$O""  &@@&`nm%%%O%@ %&O" " 㿠@ L aT@2@ ;)@X)c\l @p  &`"H @ӑ(`&@Y@D(%> 8!8%%@: < @ 3?"@1p?# 2?``"@, @9  @&`mm%%%O%@%%$O %`@@ `%@&O?2@' '  '` 㿐@bM @"@G`@? H@"@```@:@A@)@2O H H? @?@``@h@ @@A@ @2O H&4@ @bR 㿠@aܶ@@!`"@ \@-b))@x%)!)#@i?#@   X@ @@ 9a@Y<@M? 㿘@`@ @` 2@ d +@@%& df@@c d`@_ `@ `@i@"@U` d$`Q`@P@i @  d @?%``` '`!`@ @#\#` @Y `,@@ #\#` @X  ``` '` 2H  N``` '`@^  @hː2O dj``R "H_ @h@]  @C`` '`!@ @#\#` @YJ `,`@@ #\#` @X ``` '` H `'` & `` ?'`@   @hzO `` '` @& @-Y@@, @hb@ `@-` @[`@7/```@ + %&@`!8 @'`@%#?@&``?jxmx?"% % % %O%%% @, `%&`%?6O`$a/``'@@kxl?x#`$ $  $ $ O$ `@ a$ #$ 6Oa@@}?$` " `@g2@ X@@a))#Ȋ  @ ``& X  X?& X`@%@``@@T d&Q& d` '`  & ``@@,@@,4`, @/ !@ `#\#`@W ! @"H #\!`"@!#\#`@X. "H! @&! O` @@& d@ Ěa!`@ @*, `@ X@@  2O 9) # X@ϐ`@ @`x`@L@$O,0 X X-) & X X@& X @ @ː @ `@@3 ) @)@ @@`@ @`8@ $O,0@  @@d!@s@ c@@@/' &@ 8%>`&<" 2? "@`1p?@@HN   @  ' 2ON @ &N ` @  `' (ON @))@ϐ#쀦@?N N `@ &`N`` @ N&` O&`!`@ 81a`@f:` d@& d@Œ X@ @@ؐ@`@@@! @ @\oԔ'+ ! &!& d&  `@\^Ԓ`@&`` `@`"@`ƀ` @"@@&`%h@c@@`@ `/a@?@܁@ 5a@ߐ?@с;a}<@@I 㿘@bܤ@@Ґ@ &@, " @@C9 "0 @  &0 "@  B&& bD @?<\ 23* o`+)& c @   9* 0 @  ?@$ @[/@l `@@f @a@[@Ԕ @&@[㿘@`@@S@ v@  " @)@F9 "0 @@  >2 "@@  >) bD @@?<\ 23* o`+*#\\> `X @y   9*  @o  ?@$ @Z@ `@@ @ߐ@[@R @&@Z㿘@bظ@@А@ &@*  " @@?3 b0` @@ ` 3?&`@ @ != ` @``& `# bD @ HZ`{&` @'"`@Z?$@[K` @%`@Z2 "@@n @@h @c@Z@֔ `@&@Z㿘@`@@<@%+ b0` @@3 `&`b@@`B&`@_@ ` @"`@Y㿘@`@@@%+ b0` @@3 `>`b@@`>`@\j@ ` @"`@Y㿘@c8@@̐@*# b0`  @+ ` 30?&`b@ 3|`@``&`@Z` @"`@YjP` @`@ ++ `@ @@$ `" $O.`'@@L@  @@y @t@Y@ `@ ` " @@Y!$O@@@ m㿠 d& d' d㿠 d& d@ ' d㿘@ @쀦``|@:@@7@YH`@!  2@ ,   @  @@7**༊ܒ  @%  @L@ "H `@p @3a}t @L0 @벐@`@ s- a| @S?& `  $ @0 #=/`%@&@) ` @#```l`k ```# @ #?#?O#? @@-#?`# `` @$O`$ '@ `@'`ml $$$O$6@ $ &O@ ' `` @l@j !@e a}@ ?a@ے )a= @Ӓ `@8% `@@X d@@@`@A`@$O`!)a d'J d `@ d `'H` @ `'H`O `@  a}@)a= @@X@@l@%@WҐ! '! @% `@'`@W @ @@1*9*   @ @a\ @?㿀@cD@@@}5  2@@Wg  ' b&`&&& @ P&@Ӕ.@&&@@; 0 @ a =@ @  % @   @ @   `@@W@  @% @W;@x @@r @m@W@ ?@ &@W;*` @Д 㿠/@ !`@` !`&  &!&!@ ϐ " " " " !" " &!㿠@/`ĺ@+@  " |d@"  @΁㿘`@ -`@\ @W6$` `$O/`%@#`#\    @@  @ 㿠! @>@   @52O   "`@@ `"@ ""2O )@ @&`&?& `@ @ @y]?@㿠!@E@b`$@H``@   @T @?  "   @D `@&@V@@/aȐ@?  `" @* ` @'`@V&@@Ԓ  `"  @  ?`@& @Vȸ,@,``@ `?@`O,@㿠'H'L'P'T'XH㿠 d& d'`d \ 4H" \  Ė`" @` " @ "`@ "@ "㿠@7 c@ @- @Uy $"  " " " @۞㿠@ bԀ @@+a}@] @@@V@ 9" "  @蹔5& & 㿠 @? `@ &` 㿠@ a@`@/'a@]Đ@ @@ @  @@@`"  "  @~ @ ~& @UŐ'  㿘@9` a,!@@@(@U@Ր  @ @`,`` O$@$ `@$ ``"@& @& &   @ :㿠@ /`8`@@" `"  @!&`&` 㿠  @&? `@$H`` $O `@}& @&  `@``@$O`.@i & & @.TTTTTT TTTTTTTTT TTT @TTTTTTTT T T TTTTTTTTT TTT LhH(4LhL@H(4t@瀦`<@@ 5a <@ +a;~Tb @{ "@ `@`"H5 @ !a>\ @ǔ @T''L`@Ҡ  @@O@?!`@(8@-€쀥@ 2@ '9*!<@  쀥@ @ '@&H'$ @2H'&H'$x쀢 @@'l@g@@쀥@ /`O@ 'Oa@O`A2HO`Kb@O B2H ``;  ` =  <6 ;5 @  @  @ @ @ @@Y쀢?@ '`/`@@1ݐ2@q 쀥2@'`4@;*`==`I N 2OB a @  5&H@' @ |@* @S&''M``@5/   @0@&쀥@O`@"@OO@?H`% @`8@ة*`@@  '@@'@@@ '쀥"@'"4@'"'@@@''O a@, @ @'@'@ '쀢@ , @嗔@'~@叡8 # @噒'n,@R@`"H `=   9 @4HO'쀢`B@'@c K@ `1@`0,  `@, `;`@ + @ @ @*   '@&OK@&;`5*h@>  K@1@< ``0@.< `;` `@ ) @@ @*  '@&OK@;` @*@ @O`B@  ! ,* ' !@ < *  ''*h:@*  ':@*  '*O* ,@R?@? "H  58  4H O'쀢H@*@v H ` @Ѐ @*4H0@*`@*  '&OH*0-*p=@N  H @`@1?Ѐ @:4H0+ ) @*   '&OH0 *@(O`H@**  ' :* `'7*p@@S3* *#\*a|!a@f :@@* ':@9* '*O* 0@ , 'ؒ@'' ,@/Ð쀥@'쀥@ ܮ O@@  &OܦL `O 6  @ 5ax @ǔ 'Ԑ@" K@Q ''L @ ?#`"   @쀐@O@?c"@@`8!@(` @ '%"@%4@쀠@ '"@ 4@ '쀠@ "@@@-*@@B@%' O@% '쀠 @O A@@``@` @ 4Ou ,` `" @"@%@P @`T@ԁ @Y;*@@s@%*` '쀠@% '-@c@O@ @PNO쀣 b@@4 > `+`@?`` ` 0@  1*  쀦O> @ =` `@ - @@/`` ` 0@` 1*  쀥@ O=`%,` @"?@%@O @ ` 8 `:@>ԁ @:;*@@m@%*` '쀠@% '-@@O(@@O֐O쀣 h@@/ 0+ @?`` `I*  쀠 O0@ 5`@ . @@/`?` ?``K*  쀥@O5`%,` @@1"@%@O-@ ``5 =`j@ԁ @o;* @  @  @ @ @ @@Y@ Ԋ%@@qO@,`@%: .H '8= I@ @[@N쀠@O @Ő @.&OO8`= H@ %`,` @˜"`@%`@N@ `M2O#&@^ԁ @Z;*aА@~ޔ  @PԒ@5*'*@*@~Ș  @g@}͐@S@4԰ 㿠 @L b` @ @ & L ` @ & L ` O `2@.`   & M *@ & ?&9   @@ &?& 㿀@ဦ`fa@@`W@E`d"@ 䀦`f@`w"@=@Pݒ@`d @ @ & @ $ @ >`P '  ''@M `& @TM@`w 2@4&.`&_:p.`&_9p- &_8- &_8p , &_;(,  &_:0/  &_:p8 .  `&_;p8 /`&_:0.`&_:p(.`&_9p - &_8- &_8p, &_;,  &/  @R@`c @`s&S(@`S&*`&:`E)`@`i &=- &7,@`I &* &9 ( &;`/ `&; .`@`&? .``&=-``&<,`&*   @q`f@`c@ `I@B`S"H+ `W"H `c@`dH`s@`f@`i"H" `s@ `w"HU  @*?(  -`/  ./ @9? (  *`* @@     , (`,@ @ 2@ 0@Q@`  @ @\&@Q@Q `" %`    (p  *@+0  (p @ )0(@*0 +08@ @10 @R    * *p +@ (( (p *8 *p0 @0 @Rr@  ;``@Nd@ߵ @N 㿐@@ڐ@ @ ?@" @LB@֐2O @y㿠@߶a@@@@;a~@T㿠@ߚa,@@q@ @ 7+a~@@T@X@Q㿠@ߐ`|@@R@`@;a~@Tc㿠@ߐ`@@:@`@ 9 +a@@߸@@TD@!@@ 㿠@   P@'b@@z@ ;al @ކ ab,? @ "@ `@`@n@.@ ' %`  ` @ 2@ `@` @ @LDH 6OH aܒ @6 @ А@Qv"@  @2 wЀ @!?ϴ _@!2p @K_И2 @@ 7*ℐ@S  _2 @Q `@@ @  @@O `@E@2@KQ`@!)a?@e@3*@!< J@ ) %1p -? < (&@O 3*b@@  @ a? @ݱ @؟@O `@Q@>@P@ `@;*b-` 1a-*?Ԧ `@$ 2@/ @@Jܨ @ @KmH `6O`"H _a  @_ 2 @ O `@ @%6a.p @@(  +'s`!`;`|<  @Ζ [`@ )`s`@bܐ @ݯ[``s``| | <$@ @$[`'@6O @ %2@``(  I O%@ @?@TT@YT(@@u@@!``<,<0 @t  -`)`4<8@ @ݪ$@@x7*3*b−@  @UT @?@xܐ(@|?@:@8T 㿠@   @ܚ @܀b@ @5`< @܅ @I @I`h@ "H /`&'@  `@(9@ 7? @l@I @2 @ \@``2O &M@:@] @  @@   &Ol @ Md@ `|@e"H@@  O@%.@2 @@IM;`|t@<`tr?@y@x`|l@ ?  㿠@ۺ&c`@ @-` @Д @ @w @ @@y|7`@wĒ@Ք? ۔ @ym@wӐ@L 㿠@۔b@ @`< @ې @;` |@!  `" @@ @@1*@H-*@"Ȓ @x @ ?`@$@HB㿠@@b@w7 㿠@   @9 @ۀa,@ @`=(  @$ )#`"X}<@ٵ "@ @H `w@HHS`p@@{ '`H1-`@"@   @w@ܖ @w  @$@k @HD@n @v 4$@[ @n6D @Ô `@ @ں  @!@ 1`=T @ڬ `2H @vА@k @l? @H @( 㿘@ںb@ @'`` @@~ `@@G @a&a`@ ;`} @ @$ a &a@vJ h@ڀa@ @1`=  @F@k `@Ma`@ 7`@n`Ȑ?㿘&`@1`@ڮ=`ܐ@ @ 2@ '@J@ @R 㿘@ڀ`T@ @ `}Ȑ  @@@@F@u͐`@?"`@F)`=آ @G9@i ` @"  `@@G%@ِ@O@В@ @u@&@F ?@$ @F@ $x<` <  d `h @ـb4@@ 5` @f `;,bl@ "@ @? @,@ `4 @@ `>,@ @ @1\ @KA"@\ 'T'X@>T"@@uG/*@Ff9*@"̖ @V  `@ې@ @u)@J @@ `@ @ @ @F0@@@T@-_@@ @t& 4@y @E @j@q @b@i @[-_@E@ɑ"@[ @tɐ@i? @IŮ~,1<@e 2  6 30?1p?@t` @FS @,>, '<@H 8 2 @ @ 5 1p?0?`@t@F6 @ -`L @V @@ @t;  @ 9`?\ @A @7$H ' I.@"@  @ @@Et;*@*c@u8  @t2@̰  ' 4@ư @D ` @֛ 2@ `@  '.. '@i"@` `@i@<@`7*  @ @E#`?@t  @N @@E`@E`#\  8 L@tڔ @E`@E`@:#\ \ x#` @tǘ @s @ 5` @ט )?Д@e@ @D @`@ `  @x ,@D@ @1 @Iy"@( ''@v܀"@@s@D@ؐ3**c@  @@ @sa@I'0 @  ` ?@) @@-_@Dk@ǻ@ @s= @~ݒ@ @ 5`Đ @ @@ @r @)Ť>,p@ @  @ׂ3` 2?@s@D @-_@@ `H`H /`@rВ@~? @r`ܒ@~? @r`@~~? @^@e @W-_@"@  @ @@C@* +`@s  @ro`?'`4@6 @Cc @@"-_@C֒l@W@@rQ @r@֗l&@@~% @ -` @L @!/ H`@ `H +`@ +  ;+`  @|ʒ @r @H5_@r @|?@r @Ɩ7Ť,@@ @r1_@I2  @-_@ @q @ _< @ +~, 8@@ @C+ 8@ݐ@-_@i@_@q |(@|d?@q @s-_@44@@CJ ~@ @%@B@-@ @44`@44@'0@a 2@ '040 @!0@qx% 4@? @Bl @0Ŋ?@M@ @q@a@}7? @ @`  @@qG @@ -_<  @G㿠@@ @b2 30?`@q_@C 㿠@Րa@@@ ƀ@ "@ @Bc;+@3+``(@r'   㿠@Ր`X)_@`@0ٔ @`"H `@ /_Ē@``"H  ⾔ @OҐ`@7_ @pA`@)_<@ Үb@@#`6( @~ @#\...#\\&= %@@( \@&mj``"""O"`@.""``$O%\  @! h`h``   O @ ` `$O`4 <@.#d#p#t#l#h&@ %8`%=. =`@ & %=# : %8` >@ !@ & : # 10?# >$=$;!@ 2?10?# &2?#@9`$;`$=@; ! @@0?" #2p?&9 $@:$;  @="@ 20?@ 0?"&:` @8" `1p? 2?@` @ @@ "@W   @&#j< 4`@ ,ߙH@@c-`@9@̇2@`@@Y-``@`'@D-@9|J e@ @n@OЀ`P,_>D @a@?@ '+ @i- ?@ 7+ @i! `@ /`& - `"@* /` -` @9,++aa@h ,5+@9;+a` @h 㿐@˺&cT`@ @-_L @˭ @ 'A@=@1_>`  b0`  @! `'("D@Z`'@>Ȑ@%_| _ ?2' ` 5 0% %` @՘"@ @gH 8Xx8Xx8Xx㿘@ˀa\@ @5_t  @/)%_#@ "@@?`@-`@@@@@#@*@I@ϖ@@@@Ȗ@#@C@\@@@Ӗ@@ז@@㿠@ʀa@ @%_ @W @7@]@ @fu3+-+b48@u  @9   @? a@ @pϒ@P 2O @f 㿠@ʀ`@ @+_ @ @7\@]y2@ 1+7+@f.L"P@uG  ` @@7B`@p`@eܐ 㿠@ @  @f@:7` x@ɚc@@$B@$3@' 'H+_@7 #\#` @( `"@ @2  2?"@ڰ  @  @I`@@B@`@ "@ @6$ ѕ`@"@   @p?@@ @ ` @ @?"@@o?@w`@Ē丐@G @&``@@  @@!H @5 B@O@ū2O"@@   @@H @o?@.@Ŋ2O@. @, `@t@' @?@  @@Ӑ@```@@o}?@@Z2O @d’   @˔㿠@@;_ch@ @ȵ @D@@dא@9 @dѐ@9  㿠@Ȁb@ @1_? @ȏ @5@5 @[2@ @d ++"dh@s  `@N` !@`@Ȳ@``2O` ?`@ @A @@d@8  @4  `" @,  @$ @5(`H@5@da++| @sx  @dT@8  @dN;+3+#\/+bbؖ@sa 㿠@@1_`?ظ@ @ @5J@@  `@@d@8K @d@8E  㿠@ H@5&"@ @c @;_c@ @ 㿐@ǚcH@@"(@  H_@4J :@N :@  N`:@N`:"O @ @A?@@  ğ"@V   @P@n@I@"@C  @ `@@  @E@@m@x@Ԑ2O " @@  @ "@ 2@  @m֒@W@ó2O @c   @% 㿠@ @  @ǚ`@@@ @c4@nԔ? ;_@c,@n˔? 㿘@`d@@c@7H  @c`d@7A  @ƀc@;@@7V2@< `4@ `d`d@@'`d@@2O @ @b @bܐ)+@37+"ܔ@q  ;^|  @ƚ㿠@ @ƌ  @1^b<(@@ @ @b@nE? ;^@b|4@n<? 㿠& @@/^b\@@ @[ @ @@3@㿠@  `dH@3`d"@!  "H  @0 @ @b @5^ah@  @㿐 d$ @(?`@A@  "2@` `` 2@` `@@@l@` $O `  2@` ` 2@ ` `` @l|@$O `@Ւ@F2H@'  b2@` `2@` `@@@lV@ג`  $O `@@2HL?  `"@ `@ @l5@` @$O `@@2H?`@@@~@@@?? `@`("@ @  @l@@2O  @`(`@@  @2@@k@e@2O @#? ` @`(@@  @@@k@B@2O   @`(`@"@   @k@'@2O 㿠@ @  @@@a@l? 㿠@ @ؖ  @;^c|t@@f"@ @` @l?x@ĚcP@@@ ''H^@1#\#` @#ܖ "@ @ܒ2  0?"@  @  @4`@ @-`"@ @X@ @#["@@W@"@ @0o@j?@wo`@Ē亐@g@6@@```"@` @!@` @WȐ@ @#@@W@ @02@?@2O2 @?@`` @@@` @W@ @"@@W@ @j?@@j2O@_Ғ |  @۔㿠&`@+^@è|c@ @Ȕ 2@``@ ?@%@0`&` &``@@_ 㿠@ @à  @;^bܶ|@@_@k`? 㿠@ @Ä  @;^bl|@@"@ @_ @k<?x@øb@@Ր@Ɛ@%''"@W  @N `d`@` 2HU`d"@ @@ `@䰐2H˺H.#^@0 #\#` @"e `"@# @e"@  @ `d@' @#7` 10?`@"@@2H" @r䰐2Hc`d`@ז `"@E@n@?7` 2?`Đ`€"@  @ʀ`"@ @/k@8@id?@@`@ğ@"@ `@@iJ?@˒ @䰐"H\7` 2p?@- `@` @?@   @@j@ @/@@@2O f ` @` "@ ?2@   @@A@ @h?@s@ϐ2O @2H =@97` 2p? @5@䐐@-  @"@@   @@@Đ@@@h?@3@2O @] |  @㿐@€`H@ @'+ '@ H2+^@/P@ @@^$@%   @/7`@@j`@j @&O |@  @㿠@`1^@<̚c@ @ @@@ʐ@ @]v @&@.k 㿈@; 'LbLa @@@L @8 @ L@ L@ & @ L@ ` &` @ -  @@ @f@@S@B @?` @@@ @ `&`4@O @- .`&` @" @-L@ ΐ@ `  O`?&`4@) @-ِ `@&`@-А@- " `?&`4@ @- `?&`4@ @- 㿐`@q' @+ ch@a@ @ ~@S@w@A􀦠@0@- @@ e@  ' 4@= @-u .  '  " @@-dOĔ @' @-X@- `"  ' 4@ @-I  ?' 4@ @-? 㿘@@%^aܠ@  @;@ "@@"@4H' @  @-   @ @ @ / ? @  @ @@ $@, @[ޒ㿠@@\@ F 㿘"@@;^c}@  @ʔ@ O@@[@0 㿐@c4@ @^=  @@ k"@@b"@&H' @T@*@'􀤀 @ - ` @ @ 9@ #@[ .`@ 㿐@a@ @^  @D@ ǐ"@?@"@ @@h@' @@K@ '􀢀@%  @# @, @ ?@  ` @  `@  @/' @+Ր@ ?@  ` @  `@@Z @Z1+@," @j  8DP\htԝX#\@c@@'*`\ @       n ^ }ض @,   #` #X@ \` @ @@? b@@F*  A > ; 8 5 2 / , ) & #    @  ?@& @+*@O\,?@ 2@ @+;`& O, @ ? ?@W- @?@W' @ "@F  & 4@A @* ?@ א@ @3 @/& @*@)@Ē @& @*ؐ"@?@@@@[ @.?@Yǐ &H'? @ @@+6'?`@`(H  ?`@ `@ ?@+"?@./@ܨ  ?@-F@Ө ? @|'@z 􀤀@ 2`> @`@ `"@K `@`"H.D -`@* @Ð; -`@*@ @3 -`@-@耠@ '8耢@6@% ?)`-`@,@Ё Z#H' Ѓ 9X  ?`@ 'H ``"@ ` "@`O  @ @ @@@@y,` @ @ "HQd @R @^`@`@ `"HV`@!`"H/O@*`̀@E@82 0p? ; @*4@"2 3?1 @@-X@s 1` 20? ! @@,i@} Rb` @* @{   @U @ 2H@ɒ`@O z @ @ "H e @T H `^@)@@{rV `@`@ `"HO`@!`"H/H@)̀@?@2 2p?5 @)@2 2? + @,ِ@@0` 2? @+@ Fb`   @U @ 2H @,i@P`@O  @@@i @t,` @ @ "HQd @R 2@_`@`@ `"HV`@!`"H/O@)e쀢@@E@=2 0?; @)9@@'2 2?1 @,]@x 4 3?`! @+n@ @b` @)@z   @@T @ @`@O  @y @ @ "H j @T "H `c@(@zzV `@`@ `"HT`@!`"H/M@(쀦@C@2 2? 5 @(@2 2? + @+@4 0p?  @@*@ Nb`   @T @' @@Z`@ O  @ @ "HQj @R 2@e`@`@ `"H\`@!`"H/U@@(y쀦@K@Q2 2? ; @(M@;2 0?1 @+q@ 2 1p?! @@*@@b` @(&@y   @S @ "@ @*@`@O  ,` @ @ "H  @l "H ` @'@@yn `@`@ `"Hp `@!`"H;i @'쀣@_@В2 0p? M @'@2 3?C @*@ @2 2p?3  @@%@'F@)@ Jb`  @x@t%@'-  @S @ @ `@Oz    ' @$@) @,.@@V  `?@%`@&"@@ %4@; @&  H @U @@V&@*V @&@U #+c@@W    "@  & 4@ @&Ȑ \'^ @ @Ӕ㿠6@@+^c}@ @  @"@ @  @ .@Y2@  @~"@%@&y @ @Uv 8D$x@ bD@@U@  ^\@@g '?' '''@d #\ ^>l @,`@@ 2@ٰ @?b@@A* @ '<`@@ '` 4`\/^t@ @bI? '(` '$`'!`@@  @|?2@ ``\5^@ @b)? '` '` `@O,`쀥@*.@%@% $@ @?@$@%ɐ``$``$`4@m @% @%m@.' ?@@M'`@I) !@r(@ܐ   `  "`"`"` &Oܩ(%-`&@6@#@V\@T@@`@@2O @ @2Oٸ쀧`@ @' @%X(' w'w'w'w'w'w'w'w'w'w'w'w'w'w'@w "`@ `@%``@ % O-` -`& O`  @ `$O`㿠@`2@ `@3@ ``2H '%`@ `&   @ `@@ %```2O %`2@%` & %`  2O %`P'@ @ c@e@@Q@ & ?@`@@G 2@'"ܔ@3"@  &?@@@$@)'@z @S-+)+%+@$#\(#4@L@ܚ@ @b& & &`@ `@$@$@'@ `@$@$@'~@ @)\@@)V@؀@ 'i@e?'c &`@ @&Œ@@&@` 'H pD?'B &''@ @ @Ɩã @ &'^e@@S@'a@@T-^ @S@@_?&@ '㿘@5cp @ N` N @m ` @ @i 0@`N` @@?L0@ H` 2O?`0`0@ N  @ @ L``0@ `M @ 2O ``"H @ ` L @" N L`` `2@\ @YN`L `@N  ` ` Oڀ?L``  @> `@4@2@h@h@k:@k7-p02p0*001p0@#@`Gu@m@ @l~@?iN`@m Gc@lqG^ \N` `"H㿠@ @  @@ @Q`?@'`@"ؐ D ,P\ht8(@ 'cԦ @ #\  @Y \-`^ #ذ @@#@J `-@H@U2@ @?c@ @/- *` '` $` !` ` ` ` @` ``@@-`@&2@ &H'`@O-`&`& "@ \!^ ?@@i  @%-`@)`@\#``@Nd"@ `#h<#d 0?#l@Qu2@3#p#p0 @c-`"H``@NA"@a @Nn2 @\T#``@N22@#h `#d: 1p?#l@QC?#p @ @\k 7 2p?lph@Mژ&@+ @h@M @_覃@Ȁ`@$  @@?@@ @\@!v@@5`@$O  @`@ `@ ???@&{'@&x'@ @˔@ $Ox&4@ɰ @! @kd `@; @ @`@ @ @ ???@&?'@&<'@n   "  @~O @%@!K @[ `@$O/@ @?@@@[ @  %   @~!  @% @!@- `@$O耤@  @`'l@ `'`#lO 2@A @P<2H/-  2@7 @P2& d/`!+@!N\5+#@Q  @ @ @Q  @$E  2@ @P @$< \%+t @P  ,8DPH@#\ #dx'#`@S `-3] |<` @@@ J -@B`\@?2@} @?,@(,@ #d"`` ``@`@-\@# 2@R  &H'O-&&`@ #h`] \D@Y d-`@`@@   ]`0H-&9H&\Ѐ@@% 1`@ 9 @[4܀ @. @@ @`@". @@[!\2@ "H52@5%  2 8`@[ 5 O&@@% 5`@9 @Z@ @t+@@Z 'd@@'@t(`@Zٔ  'd@$OD`@@ @+`#  @Zh `&h@ \@MW#\  @{G @  \@M@!@ -+\!+`# @Ng @`  @ `@&@#`@  @ `?@&`@@@&@ 㿠@@;]`IJ|@ @  @V@S㿐@`p`X @@3&`p`t @,&`t'`@/, +]|@G @C@@[]L o@ ]@@9'l  e@ ]@@, '_  r@ ] @@ 'R  b@ c1]<@@ 'D @ ]@ܐ@ '8  @!  "H1 @NI@L@ ؔ@[Ś @@ ]@$ &`p@ <̒ @@@ &`t @`4Oy  `@L|``(@[  `2@ @L2&`l 㿠@@;]aD|ظ@ @, @P@`@ @, T ' H]@y@u@L0`"@ @2@Z @@&L` @ 7@b5@`@ @Vz&    @@@*OL`@ @%@L`@$M`@Q@&@VZ @ےN@M`@AO&$@VI @ʒ @4L`@ @ 7@@a@@ @M` @ 7@aӐ@@*ON $@@V @*OL`$@@V  @   @btpp( ht `\@ x x x"#T"%p& @ p  @ XP 0  @ @a4@ @/] @& +]`,} @ @ @K<@?bĨ@@ *@?@-'@ ,9`#] -}  @@X @ @n2@ @+]}@`@ @-@L2@ Z O؋-`@,``@`@M1! @2@  @ <`57$ac`@@ @@V"`@VJ}xL@`@@ K|`"@CF@a9'@a5'KH ,  c`@ @@U`@UJ @`@@a'@a 'K2H6H@I  @#  !`@@ 4@@`$H @@ @`'@@ @&@7 30? @  @  @Ő~ @   @? @=n  1 0?`@d ;]}Ȓ @͔ ,,\l @Y    @ /] @ ?''@U6 @U2@!@qo"@ 쀤@&@=?`@ * '쀡 &H'`4@)?-,%@   @#?@ +`@@&(O ?7 <`@@@@ @ ;] ~ @M   @ϒ @q "@ @@ď  @TN'? @p"@ @@@@Tn*00200@_ '@T֐  @ /] Ȗ @ 1#] ~@ @ @  N- '䀤@F ] >(@A􀠠@.@W2@ 䀡 @!]@I@ @ * '@ '䀢@&O-;]  @ 3,`@W  - @ @`"@e   F@?T@G(  @G @ @䀣`@  `@  䀥 "H    I L  I  I ܸ -I  I } /I     )I  #@   @2@   @ @H} -L`@& " ܐ@ @ "@ ?  @ ? ܀@@   Iܔ " @7@@5L` @ 7'@]'ڀ"@$ `@@*OL` "H6@@1  `  `@ @ ``@*O `   @@z  " @u " @$ @@  @  @ ;] , @ ?''@R @R@&@nא"@ԁ  6@9?Ԁ@@ .`,`"-* @ / +! @? @? @ @ . @"@&&:O ?6= @"S @ ;] L@ `@@ @@5@Q'@- @ /] T@ @ -@ @]?p@@ -@C"@Ё  2@@FX `@ 1]?x @R.? @@^@Qݒ@  @& @1հ @Q̐@Φ ,@@S Ѐ@N̸@Q@4@ "@̶`@Qȴ@_@u/J* 5`"@@_2@#@2@@ $2`@ ; @SB/ ' ,' Ȑ@S4*OBʚ(Шʖ.жʒ(д'`@! -̒@QX)`!2(@ *@^`3  5Ю'O-@S'J Ѐ@G -$@@@'@ 5`@^5 @@5`@ ;  @ @"@ Ю'Oڳ-@$5`@8`@R/  ' *' - @R*O'ʠʞʜ@R: ЀHG̸@Pג􀦀 4@ @`@PǒȀ@ J=x`@! @2@@ $0`@:@Rk+`' ,' Ȑ@R^*O`kÑ*Шɿ-`Ъ @'+@ @P*%О`'O+@H'Jx@= +$@@@' @58@ @ @@ О'O+@$3;`@R / ' * ' + @ @QЦ*O'@$4:@Q`@) ?@%& @~" ,Д@S՘  @ ;] @~ @ -@ߒ @] @@ -@O@O@`@* 5,@S  @ ] @@ a @ ’' @OT ?' @k2@ @k2@ Ā&H' 4H '@@ Į#?@C @O@C @ ;] ̖ @  @g"@ `2@@Cːk @g@@ @`? 9`I>'`@ @3]-,@@S  g `@':;J@@ 'O:@3-" " @C  @ ;] @ @O ' @kH2@ @k@2@ @$ @!@@'@P>2@@P@`, @%@@Pװ @C2Ұ  @ ]  @8 @@#@N` @ `@t@Z'@ @k@Z'@d@['@O @Y˒ ?' @jԐ"@  @'@ '@jÐ"@ 4H'6@@Bϐo @ZG @ZA%@"'Lj@ . @@Z' '@@ZT''@Z''@N@OӒ@Oϔ?8  @ @#,a4 @֐'  @@J @ @ @t,a4@'@ @. L``@ 7@X:@N @ 7@XO@%'@@@*ON`@0@@,@YpJ @7 @Xy@:@N` `@ 7@@Xj@ O@ @'Oؐ@Mݒ ;\|  @ @ \$ @ @a@X ?@i"@  &H'@@#@YI@N @7 @X@\@*ON @@K @  ;\|4@ @@Xj ?@ir"@ 6H'`@ "@X @N ` @7@WА@\@@X?6ON 2H @В 㿘@b @`@+ 1\- }Ԑ  @ttp@b@@ \ 4@ @| /\ L@@@ "@ @?`L@-`ŀ@ \~T @ @T%\hȖ@@ @ ؐ/`@@ \p@  @/@ "  @ @  @J$ @G7,L @M? r@ \~@ @H @*( w@ \@@H @ u@ )\>@@H @ a@%\@@H @M Ò r @$ @7, @ @> #'ܐ@ .@ '쀥`@ `ܐ   `ܐ@  ?@g$ @@ \@  @@=@  >\@@o @@ w a u @|  `@`  r/Ԑ ` @`@*   `@@h*   h"@* *  * @G? @~ @G? @w@s @oIOȐ @=3 㿈@aX@ @`@`"H䀦x @ /\Ԑ  @%@"@@ ,0 @< `@ 35\+a   @2@<  @ "@ "H   "@  "H`@ &O@@`@&`!"  " "  " " " @` @K@  @И@  @   @"@  ~ @ @7`@` @` @@ # @h2O`º  @@``@ `&` @` 2H&``@&`1\>@Ő``@  @ -\0   @F@   @"@  @/ )> @ @l' @  `" `@ \8@F  @4`@ \@@F  @(`@ \H@F  @`@ \T@F  @ @t쀢@  `?@'`@ ʐ@ؒ  @`@'`@  @Fk? @@ @2O'@; 㿈@c,@ @`@`"HA @ \p  @@a@- @ ,b  @;+ @ )-5\$   )+@ 2@ "@"H&O@ ’`@#!  " " " " " "  @В@  >@U@Ժ u @ ~  @"@/   @ "@ @ @@ @"@ # @2O @6 &@&7\@] @ ) @ \?̒  @ޔ@ (  @A"@ 3\\Ԟܢ  @ ~ @ @P;'9 @鮒  `" `@ @EE @ƒ`@@E; @꼒 @ 쀢 @   @$ @ v@鄒  @꥔ ?@$ @ g` @E? @ꘒ@ꔔ @V2O' @:S㿀@a@ @`@`"Hʀ8 @ [  @F@ @$@ ,bĐ @9ה @ 3-5[0   @@2@ @ "@("H   `"@  @"H ``` &O@ d`@9 "  `@@+$ @$@o@ / [ |$#` #\ @b @1 >\f%`p %% % "  @  ; ~\@k @9?`#@` @@`@+@ @ @k2O`| `@ @kCr @ [|,  @@9@   \@kn @Q @g (@ [|4@C  @递 @ [< @C  @t @ )[,@\, @\ @]s`@%,@]i @ 7[T@\  H-@[\ @\ה H@7<`l @ & ,0 H@7X&`l@]  "@7   `@ F &  "@ H `@`& @ @ ` @ H`H@ @@ H@7+`l~%H@7 &`l &  @& 9[LP@@4`@1 L 4`&L `.4`L&L(L &L. L`&L-`L&L,`@ 6@  @ & "H$&   @)@'+; a@􀥠@@` 4@'LLP@(@L@0L&L R.L &L) `@ 6@ @@&@$& P` @ S@0L&L.L &L2` ) L &L0. L &L5- L&L+`@ɦ @ @ @&@$& LP@ W@0dL&L,`x @ @ @&"H &  @``4@&LLP @ T@0?L&L*L`&L)``0`@ 6@ @@&@$& P@(@L@0L&L U.L &L7  * L&L1 (L&L6 -L&L,`H@J @ @&@$& LP@@ V@/L&L-``@, @ @&"H & LP@2@L@/ȐL`&L W*``x @ 6@ @@&"H & 㿠@`b`@ @@4A@2[8 @?? LP@ A@/L'ᨬ &L- f `@ @ @1 &@"H &  㿐@`! `@ @4@2m5[X@?`?  @ `? ` `-@#9  `2@` ` `,  +` @N   @  2@    9  @.n 7&@ & @/LP@@5@/L E`5&L-5L&L+L&L*L`&L-`L`&L)``@L @ @@&"H$@&  @  HL%@ @+Ȗ%- @'LHP# @ @.Ӑ`&(`zH @ @ @&"H & -h% *`@!` `HLh%#@ @W" 4@%LLP`@(@@.& (&({ `@? @ @@@&"H$& 2PP` @4@.~ 4& `*4 &* &(`&-`&-{8 @ @ @ @&"H$@& PL@2@@.O`& -`yЀ`@  @ @@&"H  & ,c$@Q @$LP  (@@.(&+`&+`y@@  6@ @ @&"H$@ & 3LP @@5@. `5`&-`5&+ &+ `&*` &) y@  @  @@&"H$ & @.ђ HLh& #@ @"LP@ G@-ʐ`&(``0 @  @ @ @&"H @ & 4@%LLP`(@@-& *`&*`{ `@?  6@  @@&"H$ & 2PP`@ @-4 `&+`44&* &- `&-`&({8@ @ @@@&"H$@& PL2@@-Z & * yЀ@ @ @@&"H & LP 2@@->& H*`H@ @ @ @&"H @& LH #@. @ [~@ bLP@ F@-`&*```@ @ @@@&"H & `& & 㿠@`c`@ @@1@/[ @<ݔ? LP@ B@,ՐL'ᨬ &L- f8`@ @ @1 &@"H &  㿠``@@7[bܨ@@1L@/@<? ` -@)X@`"8#\`"@`5[@1+@/\  @<?` `+  ` `* @  -``@Ī` `,@  &@ &@,֒ @,Ғ`` @)3@ @-[D\?%L# \P @ P@,6L &L*@L @  @&"H  & @- HL  @(@& @_\;[d@' ]?TH/ L#@h/ " "&` PL2@ @+ $  .@  @ @&"H  & L`H& ` !@@(@ & @%[\ ?H- L%@h(`&"@@" PL 2@ @+  $  -  @  @  @@&"H  & HL# & " @- @& `` @(@ @![\?@ٔ?LH& &&@3P@@ @+o  %5 $ `.5  5 $ *  $ *  $ ( `$ (`0`@1  @ @ @@&"H@ & $hP(@ @+= $  $*   $ * @ @ @&"H& h ,"c(h%h@  "`LHh!@@%`h' \& @@& @%LP @@ @*  $ .  `$ .`Ѐ`@B @ @@@&@ $@@& 4 LP @ @*ڐ 7` `$ .`7` 7``$ -`  $ /  `$ *` `$ )`耦 @ @ @&@  @&  ?& @ b`@#\ @#x `#`#t @7 )`@t?  @:#d?? `@   -O@   -O 2@Ѹ 4`@8@##l쀦@@#h #p &@@ t&`h 2@ ?08H  .#pѐ#hΐ#l#.@#h#l` & #p@? &#| #l@  #p3h .#plh$; "@% hl`@&`jk " #?"#?"#?"O#?@."#  $O"%h l& @&mm %  %?%%?%%?%O%?@ %%   &O%`& &Hd&Hb?t h5l *`% 2@42@ @Q"@Q)`@Kq@R @ @`  @@@ Z@`$O`   ` d (O™5?@#|   x   @(.`#" |" " P/ #|    x@(`@`#|@O x  @(.Ӑ# " |" " h#l,Ɛ`@"   `  @<x@(Y%  $O % `#@$O/ \+#aaD@)# @){d#`@Lt  4 `  *` @@~ `  @!@ | 4@%LLP`(@@(Ր%*%(`@A 6@ @ @&@ #@& 3PP (@@(%+7  7 %*7 %*`%)`%(``@ @ @@@&@ #@& PL 2@@( %* ~`@  @   @@&"H  &  `+d Ov4LP`@ C@(]`%/`%0`,0`0`  %+ %*%(d@` @ @ @&@  @& L) Hh$+ "  LP`(@@( % D- `%(``%/` %/ `%+`dȀ@ @ @@&@ "@@& @( H Lh#@ "  `@$̖p@& @\;Z| `@`/?hHL@% $ PL2@@'Đ % ) ~ @ @ @&"H & hLH#$ x@3 P@@ @' #5 `% `(`5 5 %*`%*``%,``%)`a`@0 @ @@&"H& #LP @ @ @'m "%* %* a`@  @  @@@&"H & LH!@ @(ɖ @h`x@  % H@ ,`3` #,`3`,`3`,`,`L ",` ,`Lh1, H#, $@% \p& @; @&LP`(@@'% (%+~@B  6@ @ @&@ %@ & 4& LP`@4`@& 4`% (4` %,  %+  %. %*~ @ @ @@@&@ %@@& & @  l` @`$O`h쀥@hːlȐ?&` @+B@)\5[@6?㿠 .&`" " @h"     `.@U" `@2 '=. % @&@+  `@%` `k`k `#`##O#@+#`# `$O`"$ &`@&o`o  ``'?'?'?O'?@ `' ` &O`$ $O㿠 `@    5 $O /@` @    @&͐P@&ː`  @` `@`  &O`#Z #\|  @    #`@&P@&`` @`@Z|,@@5 @@`@@ـ `+@B& @39 8`"  @@%@w @8 3p? (`@*E @"Ŗ@XT &@T@&kPT'T,P @&  ` @'Zh@ߔ?``@z /`@$@`@ `\`@Ք@  @` (`@ @*@(f1Z <@@5X?u` @`& ` @"3H @f<-Z@@d <?\`@#@,@&`'@&$ PLH@`#" @& x@% ` 8`@ `   `  *@  @&O-& |  2@ 2 - ?HL`! @%@*PH  @ &@ L ,'@-ZL   +`+ *` `,66, ,6,@@4? 6O`& @$ϐP@$͐ 㿐@`c(' `@@@(h-Z @&̐@3? ` `#\+` @^ @)'@E`` ) `H```@N@@1  $  @ ?`@$ @M @`(H9@ۘ ! @%` LP` (@L@#lL &L. L&L+ @K  @  @ &"H% & =LP @@ @#IL4 ``&L(`4L4`&L+`L&L*L&L.L`&L)`  @  @ @+ &"H% &  ` @@+ ! @bH@G&@(PLP @(@L@#L&L .L`&L*` @n @ @@&@%& L@ @ @"ܐL&L- @P @  @&"H &  &@&PLP@@ @"L`&L,`L &L+  0 @) @ @@&@%& L@ @"L&L, H@  6@ @@@&"H @& LP@@ @"{L`&L,` ` @ﰐ @ @&"H & ;! a @b @Y`&@3LLP @ @"NL`&L,`L &L+ ``@L @ @ @@&@%@ & LP@2@@",$.P@ @"L &L) L`&L(```@ @ @@@&@%@& `&@4LLP(@L@!L&L (L &L. `0@L @ @@@&@%@& LP@ 2@@!Ӑ%.P`(@L@!ŐL &L / L&L-`H`@3 @ @@&@% & LP @ !@!L &L* L`&L-```@ @  @&@% & 㿐 `@ @`Ā @@&@$w5Z   @1i? "@` `` #\,   @ @`` ,`@d/@b  @%` LP(@L@!7L &L) L&L(`@L  @ @ @ &@ "H$@ & >LP` @4`@!L 4``&L)`4`L&L.L&L-L&L,L&L+@ @ @@ & "H$@&   @@)'; ᨀ`@H @`@a4@'LLP`(@L@ ǐL &L X) L&L. @ @ @ @&@$@& P @ (@L@ L`&L Y*`L&L1` .L&L0`-L&L5`,L`&L+` @ʦ @  @&@$& LP@ ]@ lL&L, x @ @ @&"H &  @a`4@'LLP (@L@ GL`&L Z*`L&L. 0`@ 6@ @@&@$ & P@(@L@ #L&L [*L&L2 `.L&L1 (L&L6 -L&L, H@J @ @&@$& LP@@ \@L&L- `@, @ @&"H & LP@2@L@ϐL`&L ]*` x @ @ @@&"H @& 㿠` @ @`    ,` L % @c  @׷ ᨀ @@%` LP@(@@&- &) @L 6@ @ @&@ %@& > LP` (@@g&*5` `5`&-5` &) `&(``&.``@  @ @ @@&@  @@ &     @@g )` &O  @ @"'LP@@ P@&,``"@J  @ @@/ &@"H @&  LP` @ ^@?4 & `,4 4 `&*` &) `&(``&.`aP`"@  6@ @/ &@@ &&  㿠 @ @`耧`@i/,ᨐc4   @Ж @&LP`@ @ @L &L- L&L- @ @ @@! &@ '@&  LP@ @L5  &L- 5L5`&L.`L&L*L`&L)`L&L(`@ʺ @ @@! &@@ '@&  `@L`   '  - @c  @` ᨀ @%` LP (@ @3 $ * $ -@L 6@ @ @&@ %& > LP`@(@ @ `$ .`5` 5`$ *5` $ -  $ )  $ (`@  @ @@&@ ! &     @@A * ` @&O LP@@@͐  O-6 $ * 6 6$ ( `$ .`  $ +  $ -'p @ 6@ @@% &@ $&  㿠@`b0@ @5,8  @  `` `, @f)!@Օ  @& LP`@@ @jL&L-L`&L+`@P @ @ &@ !@& APLP@ @7`@FL 7` &L . 7`L`&L.`L &L- L`&L,`L &L+  @ @ @ &@ "&  P @@PL @ Q@ L#a&L,'`@ @ @@3 &@"H @&  㿐``@ @ #l` `#\,  @ "@ L`@y3    `` -` @b ``@ؖ ᨀ  @$ LP@ (@ @ `$ /` $ (@J 6@ @@&"H&@& =LP  (@ @ `$ *`5 `5 $ ) 5 $ ( `$ (` $ *`@ @  @@&"H&&  `` @'@. O`/ᨂ@h6H`@  L2HALP @4@3  _4`$ `(`4  $ -  `$ -` `$ ,` `$ *`@ @ @@&"H&@&  @B`@  @LLP@ @7`@  _7``$ )`7` `$ (` $ , $ , $ - @ @  @&"H&& @`@6@LP@@ @ `$ -`@  @  @&"H  &  6@'LLP@(@ @  $  *  $ (P @㘐  @   @&@& &  P @@ @w `$ ,` `$ 3  *` $ 1`( $ 7`+  $ - h`@  6@  @@&@& &  `6@ LP2@ @=  $  ) 8 @ @ @ @&"H @& } a6@'LLP`(@ @ $  , $ ,`@c  @ @ @@@&@&@ & U P (@ @ $  ( `$ 7``+` $ 5 , `$ 5,` `$ *` @,  6@  @@&@&  &  LP@ @ $ ,`@ @ @@@&"H &  2@ LLP@2@ @ $  `(@I @ @@&"H @& <P@ @ a@  $ +   $  2` )  $  7`+ `$  5 ,`  $  + 0@ @ @&@  %& `2@ LP2@ @F `$  /`@@ @ @&"H &  `@ 6@ LP 2@ @" $  * @塚 @ @@&"H &  !6@'LLP`(@ @ `$  /` `$ +``@Ȫ 6@ @@&@&&  P (@ @ܐ $  ( `$ 0` ,`  $ 4.  $ 5*  $ * Ȁ@ @ @@&@&@&   6@ LP@ 2@ @ $  *(`@n 6@ @@@&"H & a !6@(LLP(@ @ `$  /` `$ ,`@G 6@ @@&2@&& 8 P`(@ @Z $  ( `$ 7``,`  $ 4.   $ 5+  $ * @ @ @&@& &  㿠`@ @`X @ @, %Z\  + @2@ @ @ J `-@ J `-H`$$@  @[2@ ` @O܊ $@   (`@~N-@z `@k/ ,c`  @ @(LP`@ @L`&L.`L &L+  "@U  @ @1 &@ '@&  LP@ @L5 `&L.`5L5`&L-`L&L*L&L(L`&L(``"@  @ @1 &@@ '@&  `@,L ^@    M?$@ `@ M?\H  , @@ L.@ M*@ @@I\@ZI .@ ZI*@Z ,Z~d @@ @5@ @s@h%@@3 ᨀ @(` LP(@L@L &L ) L`&L-`@ȢL 6@  @@/ &2@  " & LP` (@L@L&L *5L 5`&L)`5L`&L-`L &L- L`&L.` @L @ @ @ &@  @ & D`%@@~ ;`%@ *-  @~ؒ !` @ *-`-@ϯ @'LP`(@L@L&L -L&L*`@FL 6@  @@ &@@ % 6& LP`(@L@aL&L (5`L 5`&L-5`L &L+ L &L* L`&L)`@L @  @ & @ "& OM -`@f`+`@B a @&` LP`@ @`$`,`$`*`@P @ @@ & @ #& A LP@@5@`  5$`*5`$`,`$`*`$`(``$`(`` @ @ @@/ &@  @@&  `` @@  @)@'`@%LP@ I@`)! $` * f`"@C  @ @@! &@"H &  LP`(@`@``$` N.``ᨪ $`+ gX "@  @ @@ &@ !@&    㿀 @+ @}la@@@-`h$,@ `O 䀡 @H 䪅O@` @ "Hk` '!,ᨺ#d @E  @&LP@@ @L&L+L &L+ `@ @ @ &@@  & PLP @ @L4 `&L-4L4&L,L`&L.`L&L*L`&L*`@ @ @@ &@  & yP` `*@ @g@ `3`a@ۖ  @' LP@(@L@L`&L +`L &L+ @P @ @@- &@  @@& APLP`@ @L7` &L+7`L7`&L,L`&L.`L&L*L &L*  @ @ @ &@  &  P`` @'@PL@2@L@NL &L+  ``"@  @ @@3 &@"H @&  㿐@|``$@@@@%5Z t@%?`` `#\* @ @5 2?@ , @ `@h@  % @  @' LP(@L@L`&L )`L&L(@O @ @ & @ #& @LP`(@L@L&L .4 L 4  &L) 4 L`&L(`L &L. L`&L/` @ @ @ @' &@ %&    @ [@`2@LP2@L@L &L  ^. `"HNP/; ᨀ`@ `@x4@3LLP @L@^LL`@&L  )` )`  *`# `! .,`@B 6@ @ @@&@ %@ & P@L@.L@&L  ( ( )`"@ $, 0`.  $3`- $4`.$*@ 6@ @&@ !@& LP 2@L@L@&L  * * + %@ - `@ր` @ @@@&"H & @x 4@3LLP@L@LL @&L  )  )  / " *.@ @  6@ @&@ %@& P @@L@L`@&L  (` (` ) $`$/ 0` +`$5`.$4`*`$*``@^` @ @@&@ !@& LP@ 2@L@JL @&L  /  /  ,`%@- @4 @ @&"H & L@2@L@#L &L .  ᨡ( $+ `@ @  @ @@' &"H @& LTTLLLL DLLLLLLLLLLL㿀``@ @y  h, `@ R`ZaP@ ?X@@xH "@ @%@抐@a @%@恐@ ?b@ @ - @Ā 2@ ``  ' ,`L    @c / @ʵ ᨺ@ @% LP @(@`@`$`(``$`*` @L 6@ @&@ !@& > LP (@`@f`$`*7`` 7`$`(7`` $`* `$`-`$`* `@ @ @@&@ #&     @ @ +  &O LP 2@`@$``$` I@ I K(``@ K!) @#@-@"@d  @  @+ &"H  &  2@P ` `  ' - L   @c  @  @@%` LP (@@א &/ `&)```@L  6@ @ @@&@ &@@ & > LP @(@@`&+`5 5 &/ 5 &) &(`&*`` @ @ @@&@  @&     @ Q@ - &O LP@ M@r;a&@*@`"@  @  @@9 &@"H  &   2@ ` `*  `@q@! !@ @* Z`@x_@@X @'LP @ @/L &L- L`&L)`"@|  @ @ @' &@ %@&  LP` @ @ L4  ` &L- 4 L4 &L-L&L(L`&L(`L`&L+` "@G  @ @ @' &@ %@&    @ "@PL 2@L@͐L&La L+@g( "@  @ @+ &"H &  % 8@ ` `- @@    `"@  $@  'Zd@w@2H     ,` #\  L ! @~7  @@ @ @" Zl@x.@2 3?``@&`@+@~ @&LP`@(@`@U``$`\/``$`*`@L 6@ @@ @@&@ &@& > LP(@`@1`$`+7 ` `7 `$`/`7 `$`*``$`)``$`(@ @ @&@ !&     @Ζ@W *  &Os ᨪ@@"fLP2@`@`$` I-`"@9  @ @ @ &"H @ &  LP(@`@Ȑ` $` N* ` $`) `x"@  6@  @+ &@ % &   㿠 `@?`@;`  ` `- 2@, @ J`)@$"` @!@`:2H" J?:"@ " @ J :2G" J? :2O"   "`@  -  $O P@v`aL @@@@Y5Z t@@K?`` `)` @` `, @`@@` @`  "  @ @$@@ &@ & @@  HL'`@D &@ &@zH`L% `  @ ֖@& @Y7Z@@v =?OH- L @h- "@#@" PL 2@L@АL  &L! / @P`@L @ @ &@ "H & "HLLH#@$@( @&  @ Ė"H& @!Z?@?&HL@&%@5P @@ @  %7 `%  (`7  7 % - `% .`  % *   % ) `@ @ @ &@"H& hP  @ @L  $`% *` `% .`耥@n @ @ &"H& `hH a @%@@5PP @ @   #7  % ) 7  7 % + `% +` `% .` % *`@2 @  @ & "H& $hP@ @ @   " % .  `% +`耦 @ @ @ &"H& h@% h@$LHh#@ " & /9,ᨚ#h@  @@ږ ` @'LP(@L@ L&L (L`&L(``@D @ @@ &@ @ "& 5LP@5@ L 5&L`(5L`&L/`L`&L-`L`&L.`L&L,`@ @ @@ &@ @ "& &  㿘@t#\#`a #d`@N@`L`{@I ``K`)@       @      N  (@ &OL       % @   `@    "  "   " " ~` @?    ? ``@?    5 / `@?    * @``J`)@?     `@ ?    `N (@  &OK ?     d`@|6 @  ? / @`#? ``#`$ `$ #@ @ ` ? / "  ?(" "  "  @s` @ I  `:@6@`I `:"@"?`  @&OI  @? `@ @ @`@`?`@f`@k ! @' LP@(@L@ >L`&L )`L&L(@D  6@ @  @1 &@ %@ & 5`LP`@ @6@ L 6`&L(`6L&L *L &L* L&L(L&L+`@  @ @ &@@ !@ & `@ t `@i1!, cl   @ @'LP` (@L@ ѐL`&L (`L`&L+` @M 6@ @@ &@ '& > LP @5@ L 5&L `-5L&L(L&L+L &L+ L&L*  @ @  @ & @ %@&  d@G @ - @`&`"@``' 4`\ 1p?'` \  Ēh@r 5a8 @2?@ߕhll@Дh@@3 't2@@ 3-`a@'` @@  @  ' "H '@2ƀ@ = @*Ȁ@ Ĵ @#ȴ` &O` @  `@@  &O@ @ @@  z㿠   @" @& & 㿠  8 2@ 0 `@* 0@% L ``@`@̐$O`@ L  "@   @" @[  $O & 0@ T `@`@$O@u 㿠&``a&`ad`&` d gl <&` (&` &`&`&`&` @B`$&`H&`L&`P&`X&``&`h&`p&`x&`|&`&`&`t&`T&`\&`d&`l&`&`&`㿠 T`"@ dc H d`"@ t] X t"@ W h "@ Q x @ J@q#\ Lp#d#h?#l##@1,@\@q*@\  #x  #`@ L#;  #p #t#|`d@P@d@5|@Ā@`%#`#@K ]@ `@%H9Z ?h@F?@ #$ @Ā@`@g L P @'@  ᨞$ p*h`P`@  @ @  @@@' "H @ ' d "H9 L$ @  L H %@#' " @ Ā @C  H L% !@ @ ɔ `"@#`#@qL]@ H$@ *  x!@  %  @  L H %##" ' @ YĀ$HQ LȦ ha ``@@T  `@,``,@1e `@0`,@` "@8``@#`,@! @ H L %@2 @#'  H' L` ?' ``@ *  X#+` @:`@  ``@ 4@% L L P@(@ @Ɛ $ -  $ ) ? @K 6@ @  @' @ #@' = P (@ @ $ *5 `5$ -5  $ )  `$ (` `$ +`? @ @  @ @' @ #'  ` `@A@#` Ą (@&O<`4@& L L P(@ @] $ t* `$ *` @B 6@ @ @' @ &@@' 4 L P`@ (@ @: `$ x4 -`4 4`$ *`  $ *  $ ( $ + `@ @  @ @@' @  '  L H! @d `@"#`@#@ d@&M`]@&!\@@` H%" @< ` $#`#@OҘ Ll @k%-h@  @ @+ L P`(@ @ $  + a $ - h ` @H  @  @ ' @ "@ ' 9d L P`@4@  54$ `(4 $ ,  $ +  $ - $ *h8@  @ @  @ @/ ' @ $@@ ' d@`\#`& & \`#& @/,   #"`@@\@`\ @& @/,@nL#`#\@.,@ޢ  #x #t  #l  #dL #h'  #p` @ @ "@`Y @ "H0Y`,@.`)@!X ,@.})0@e,0@  @(LP(@@`$+`$* @D 6@ @@&@  @& 6`LP@/@5ᨆ$+55 $+ `$+`$* $-  8 @ @ @@&@ "@& `@.,``` a@*`0-`@`` ,0@ @%LP@ (@@l$+$(`@A 6@ @@&@ "& 3`LP` @5 @I5  `$*5 $-$(`$-``$+` @ @ @@ @&@  @@& `@., `` @`@ $M   :@ 6@H :"@ (2@ ` `2@M )@ &OH @* @֐` @d4@+LLP (@@ސ $h+  $- ؀@a  6@ @  @&@ &@ & `` -&@kP @@5@ 5`$p5(``$+` $- $*`$)`@*  @  @@&@ " & `` *& @ 4`` M@4@,LLP(@@s`$t)`$( @  @   @&@  # & `` -&@ P`(@@J $d5 - 55$* $) `$(`$+8`@  @ @  @@&@ &@ & `` (&@Ǵ@2 @%LP` (@@ `$(` $+ `@B  6@ @@&@   & 4` LP (@@`$)`6 6 $-6 `$(``$*`$*@ @  @&@ "@& ` `@%LP2@@$l(`@9 @ @@&"H & `` ) &@D`` ^@&`dLP 2@@ $x- P@ @ @@@&"H @& `` )`&@`d@ d7Z@k`?@,Đ, @`4O=`0 4H ,l0@ ,0-@_  @' LP`@@ @3L&L+L`&L/` @FL @ @ &@ !& 6`LP@4 @L 4 `&L (`4 L`&L/`L`&L*`L&L*L`&L.`@L 6@ @ &@ "& ``@)L -  P` (@@ѐ$+ $-  @ @ @@&"H?@& `4OL`@$LP @ @$- $, `@ @ @3 &@@ "& \L @g;-c @ @)LP @(@L@zL &L * Lᨂ &L) ` @F @ @- &@ %@7& LP@@ @SL7` ᨮ&L,7`L7` &L) L`&L(`L`&L+`L &L+  8 @ @ @@% &@ $@& @+, 㿠@j`H@ @`@ ``Ֆ"@ P L@ @ L)!`' L-`Ȁ`@ @  @3 ' @"H '  㿘@iH@ #` @  @ÁL  @L#\}. `%-a  +     }@#\@[@Ė @$LP (@@%(`%(` `@@ 6@ @ @@&"H$@@& 3 LP (@@y%*7` 7``%)`7`%(%( %+   @ @ @@ @&"H$@@&  (O .`5`@)`L )  P (@@5`%.` %+ @ @ @@&"H?& a6OL`@%LP (@@% (`%(``@  @  @@ &@@ " & LP @ @`%.`` @ @ @# &"H & \㿠` l@h`L*``Hc)`" `\* `" @@, ` ` ?d@`h<@` &`&&h&& & & & &$ &,&(&0 l&4 &<&8 &@ &H&D H@h @"&L ?   @` X@L "@O`@@` XL` @"@`$O X`@ &P h@hr&P@ @&T @hg@&T@@t @ "@& & 3b& !@e@h `@@@/' &@ 8%>`&<" 2? "@`1p?@@HN   @  ' 2ON @ &N @  `' (ON @3-@h c @N  N `@#K` @ K#` O#Y8L@g8~'?㿠@= @   @ @ @h2H`@$O @? 3  @' ' &` %' &`&``&`&` &`&`@g@    @' ' &` $`' &`&`&` @&`&` &`&`.  `' 㿘``@` `( @2쀡 @ @+ P @@ `@ P@ @ 2O   @ $d$ `@` @"@$ $ $ $ $ $ $ $ $  "   $ $ $ $ $ $ $  $  O㿠 H P L'.`'@ H@g T@  H& H & L& P& T㿠@fc\@@ @ &H |Yl @ |@ @+ + ^+  x@f @  x& x& |& .` x`@ ?@9Y<@ x% ?% % % 㿠@fbd@@ @&H |)Y<А@@ޒ |@@.`/Y@@Ւ x&` &`㿠`l`p@, , # + `h,%,`@f`t@ `h&`h&`p&`t`l`h,&`l'.&?`%%% %%%㿠@-`-@fd-`@ _&&&,`&&&"   " " " 㿠   . /`@f> .`@ 9 & & &  `@ )㿠&' L H@e%& c@& l@& @#8`"@( LH L L P`(@ L L & L ")  L& L( @T @ @  @ &  "H @&  P`@@ $Ɛ L & L-  L& L.0`@2 @  @ & @ "H &  P`(@ L L & L &)  L& L(``@ @ @  @ & @ "H @& 㿠@```H @ "@  $  &+ "+ ++ ++ @e`L`Pt`@\`L`H` @?@2&H 6 `@  . & 2O `L!`@&  o?~o? ' /  /  /  O/ / @  . & 6O `L`'`L`@"@ % ',6 #,6 ,6,,`,6,6 ,6,, `,6,6,6,,``?@-&`@ `x@!@O`@ `x@!@`$O`x`l` @'. `h"*` `$ `@`"@ Y  `$ @ $  $ 4@@ $O`h @da"p 㿘@d9?b8 @@/?@; 0@"@4@`4 @`2H" 㿠@d;?a`@``@/?@`0ƀ2@  㿠@d;?a`@1?  -&D@^~ 㿠@d;?``@@@ 1?-? @`,@@% 㿠    @E @d x?`@ @`   @@Yh@S```4@` @ Y}@D` 4@```& 8@  ` @ /Y@/ `4@```` $O`@㿠  x`@&`X@cc  @  @ Y=@`4@.. `.33. .3.` `$O`&`\   @)Y>@  4@..  4 . 4 . .4 .$O &``   ! 8@.. .00. .0. $O&`d   @3Y~,@ؤ4@.. 4.4. .4. $O&`\&``&`d㿐@c`+` H;@` ,`a&/Y/ P   &@@c `@] ``$6``&5 2? 2?``%1 @#h`'`3`2` 1` 0? 2? 20?`0?`@#`` ` #d3 `5 2p? 20?`1 `@0 20? 10?`` 2`6`#\  3?0?``@ @ "HM "H$M  @A"H  @`"@hH Y~\@cv  Y>l@cn   *  *) @@`#@dH Y~p@cT ɨ Y>@cL   @Q`@Y@c> L-@@ (  `@` H<  @/ @  `@  O`@`$O`` @  Y~Ȓ@c    Yܒ @c`@ ( v 9Y>@{Y>@b e  +``  )`(@@ Y>@bܔ L-@[ ( K @@@\`H<  @/ @  @ `@ O`@@``@$O`` @ Y0@b    Y?D@b`@O (  #Y~@YP@b  ` &O`1Y?T@b㿘@4H@#x@$\㿠@aa@@-YX@bC7Y\@b>N`@G@E @?" c(@@/-Y`@b'+` Y?d@b $`Y?h@b`Yl @b`!Y?p @b `'Yt@b`+Y`x@aN`@`@O;Y|@a`; @O;@M@ H?"H+?? @* ?"* @ (!+` ` @: ?UU~J@ 2 9 :  +  @ *`" )`")  (#@(` @: ? UU~H0  ; : " ) !@( @* #*` )`#@)  ?㿘@ `>"(`@$ z>!H@20 >=#*#@ +  , 2@ z>K 2 :>$@-`$,@*`@    |? @"  @퀦`@?' |)`@@ @〡`@,1 `!| @&` ``` ` `ma ````@O@ ` `$O`@<@'!= !r d F! c ` * @ 2@  4 3?  5 m` @ @  2` 10?  % 2 1p?  @&Oԛ= M,@J!z>K 2 < >< &@*`!. % -` (`@ * ,`&> d&! c . @ 2@  5` 0?`$ $>6`    @ @23 1p? 30?    @&@%@Oԡ>,@?+ `" .`\-`, !@) '6@?`@ @ '@Z  `"@dd& ?㿀'DD'H@Z  UUH>`>J 2p @Z   UU~:H0 < >>:%&@+`-`# %D/`- " H&' %-"@.-㿘'@Zm  m<`&<`J 2p @=<`%@,%$@()`!(`+ 4@/`"/ '@* * '㿐'@Z?   @" @?" #d 'l#\ #`  a 6@ p@'D& @_D`+?@a`@Z   UU gl#d.@$ #\,`#`  :   I0 8`: #@ ,`"@ . % `@ D@Y * &-@'"@D `$@?' #d#\#`   @ `O?D& 㿠.`@/ &--` & 㿠@^9Yb\?@@7@^@CY@^@<7Y@^@. Y@^@( @^ @*@^ @ 'N `.@'. ``@57`@^@ ` ` `O'71B` P&`#` @ `@^@ ` ` `O 7B`P ' `7D@D`@^K@ ` ` `O B` P "` @ < `@^/@ ` ` `O )B` P$`@^" Ns@.@#`< @^ @   `O |B P# |@'`@]@ ` ` `O N 1B` P&`N `@)N @% %   @@+ `D @]@   `O N /B P%` N @1/D  ."@+````O` O .+`"@+!`"@'!`@]@ ` ` `O! B``P `. ! !B P "!BP! 㿈@]1 7? ጢ`K``@``K`` @ K``` @ 2O`` @ @D`@% H$`(K` @ @`.2H, @,  J `G.O, $`]`(@  M``@``(@`)  "H? G $`K``$`;B`P% K`  @`  -Л. % N `O-$@$`!$$`! `;?.p /?ϛ6@'a`@\ఖ∬5 1p?&`, @W`   &'l&&@&` &`&`(&& &`(&Ԣ &&&&&&&`&` &`&`&`@&`@`@}`@z` @w`@t``@q```@@#: & d@E& &@Дl&&`(#d#\#`쀐@?` '`@``.`%*`) $@- , &&' '6@?ܐ 'g6@?` @ @``@'`$` `@ : '`: w  ?(HhDd@t   4 ` x4 TlDt㿈@[/bĔ@; @cax-@| Bv d";B!`<u% )B LB# 3?1B`a@`HT? `?ڪ? 4  cဂ0? # $ `#`#`#\#d#h%@|B`d5t+@v axu |. #p #l`/5  `+@ @ @5`%@&@ 3;`c 8 `@ `=`:  @.+ -`@[@["@D "HA   (@[; cc# )`@[,3c "3c -``@[R #`@[H cc `@@3 3c  @@3..c ! @ @  %`;.b %` BB Xv L``&``pl2`\ 3p?@; @ j@B`L !` BL  "`@&*(` 2H!BB1BP  H LB?  X `#(`%#pG&/BH &`@3 @-@ B`L  `B`L#`@   2G  2O  @   @ @ 2OH @QB`H H @ "@ E B@H6 ? B7.  B````#` B#H "@ @`(`a@ *. @!2H%`. #p`%`/&` @:O` @?BL " B  B``T( `H$8h8B(`Xd&@ %@ ` .@#` !@ . @ . #p@@"Gr`.. #pl`+`B&@ X%@ d"h` ,`  !@ .  (@@H B. B d#`@x$+@a|@?"BT" &  4G. @`6?c`aH=``J 1p >  =`!&@ '`@@ = @ @$ 8`=`.H# \@%8`za`J8`:`H0p >`:`#-%@+`1p  <*&&"@ &%@?H`"""%@?`!\!!`%@#?aH `&&&%@`/?\##%@?aH `&&&%@?` P&,&%@1?`!P , %@\2@ 6?H>`K 20 =` >!&@%z'`@ @ ;`@#@ @ %@ ;``@.H1 ^#@;`:K@ 30 =; J@ :6&`&20 㭓>J@ 9`;  .  `(`20 +<` # &>!&@ '`@@ 8 @ @! 8`.H Z :`=`J>H=`0p =`>&@-$@+2p  : +  & & &!%@쀤~\@C%?6H# `=I0p > = &@ '`@ @ ;#@ @  @ =;.H1 ^#= zaI=0 9 H@3 >9 <% *`&`# &*&@ &* & !&%@ 6+?caH;`H 0 <` ;&  &@%z'`@@ > # @ @ %  >`.H [& =`:`K 2 :`:J@ =`6&`20 &9`> J : +` `(`1p @-<` " &> !&@ '`@ @ 8  @ ! 8`.H Z ;`:J;>H@3 >`>$@ -`%+ 2p @: .  & & &e%@?aӒH; H 0 <` ;& $`g$`$``9  -@(%`za9 K2 =`9 & * "@+ -2@ `za=H 0 =`=&+ " * . %1` 0p? Ӫm<>K@ 0 ;>"@ -#. )`&^;`H@ 0 <;`# $`.`. "-$%@?`49 > H@<<`K@  " %@`1?!4::J@ ``&`%@?`4@#%@+?`a4:`> K@&%@%?`4`"%@`B1?X!4 "# %@`%? B4 X #`%@`+B3?`Xa4 %!`%@?h  @ @ @`&%@`&`d@ &&&&}%@;`` z;`&!H>J2 :`>%@.`#-0p @<)`#&&& &a%@5B`X%`Z%@?aH `%%%O%@?aD `$$$$C%@`z1?a!`> H 0   <>&"&.`&"&(*`.`@,`#* &@&"%@?D `$`$`$`$`%@ ?z!``  9 J 2p >`&9 &&&+`&$@ &(+ +`@)` @ (!&%@?!%%`%@#?` a ""`%@%?`&?& %@ ?` !  %@?`D %%%%%@ ? a&&%@?` # # %@%?8`;``H& & %@ ?` a&&%@?`\ "?" %@1?!H`$`$`$`%@5?h  " %@?d `$`y%@?x#q%@+?ap`  `i%@5?t  " a%@?l `$`Y%@?ax ##N%@1?!l``  &`&` &` @%@ ?'!H $$$6%@+?a<`` &` & &`(%@ B? X !%@B  X!`%@/B X" %@㿠@U9 aض!@@¢` @@Ȓ2@`  @ "@&`&`1 !&`  @&  @Ҟ㿠 @ &`㿈@U;?`c@7Y@/N@Ox @ @)?#?'#c'5M-M','''@@ $@x YN@?@ N@P'@'''''#@Y@@@''''''@㿐@T; ca@5?@-?@&@o@@Q5@  @d@Q,2O @Pڐ @Ta#  `㿠@T; bиa@@T̐uF &@U㿠@Tbx@ @/?㐢@`` $5?@ ,H  `& @@㿠@`@'`` "@` `` @@Pu`u@ @T?!<c ` 0@TȚ`;?@@N} c@P@  Ā@P2O @@lY@?' `"  '@Ò@S 3Y  . @@BՒ  &@@Th @H @)'@@ @  @-@' *@, `@&O&@@  &O@$@@Z@@P@?`@"@   @  @@OO`@O㿠@Sb$@ @7?㔪`` $` ;?ْ@;? c1?#`& 㿘@S;? ac@@ 0`@` !` @Sp s s $ @S'  '  '  '  '  '  `@+`@'  1I =@' ' ' '` 㿀@S`@@ @`?#@ @  @ #\#`#d#h   ?@+'   ?@@&@5(? @/%#`#d#\#h  @?@ "@ O۠ ?@㿀\dhl@ @R-?b@@  `@```@  @@@`#`?#\#d#h``@,@㿀@Rb@@ @`?㐰@  @ @@R#\#`#d#h   @? @+%  ?@@&@(? @%#`#d#\#h  @?@ "@ O۠ ? @`@p@m㿀\dhl@ @R3?`H@c @ `@`@R"`@  @@@``#`%#\#d#h``@`@@.,@@QcL@@ c @8-@r$@D=@*, 8?@I@,X ?\3rH`b%@RX@X @Q9r: "&@R @ ,@%@Qb0@@ ;.c@s'$@/ `@i  @@@r@ ` &OZ -Y)YȦ?Ԕ @rW@@g$O @Ȑ#OM@ D@E"H$ %M@S@  @r @j @b@@ @ @! E@`@  @c& @ ` `4@  @P;Y'cܴ@/Y 'Y''@q @A9 @t?@g? `"  @; ` @'`@@E㽨@P#\,$#`@C,@fv,('(@Q ((@Q ((@Q} @`@ (a4H!( @PԔ!q9!  @PΔ! - '`q0'a @PŔ`a`@ @  @I?   `@쏐 @G?  ' $Ȧ(@iH @J J aH@J( ( "@ "HHHHHJK@JJ+ )`+  @@9`*@ 5 O耉 OҐ` 2@ ``@ %`@`@ܐ@ `@Pb!` a`  @@ *$Oa`@ /(( (@``$O `+` '?dp'a @P8a  a `@#  !) a 1` @ @ ; a @ "*`4+ 2$Oa!+``2`$Oaa@ ` @ `฀ @ \4a`@  @ % a  `@@3(`0``$Oa a? ! @ "` $Oa@@eL@@eGO @T,,'(L R@N@ϒ @e6@F) !Ȁ@8, ` ` ` `JJ@H@H* )`. @(@' ` @"`-``2`K *`  I@NH@) -@ @ :a  *2 @   2OK@ @dO@\ LL}41K '='''"H '$' `@O/9L/ X= @ 8@8@d@\840@ ِ G4`@L0;Y @O@D0Y`@O 0@  @O% /p0@R8Ր8 X <@O0@ @O /o0@?88@O / @N0' @N /+  @', @H   @; 8o0@88"@@  o;0@N&@O @N&@O $0%5`J@ 1p &, @N@ , @N!,@ N44 ``.`,,@@  8O ` 8  .`,,@&OO N`@` (,N`@;K `  * ,'}+J}8%I '''''㿠\?,H @ ``?&d%h%@NS㿐hd\` #\#`#d#h@#l㿐hd\`#\#`#d#h@#l㿘@@$`@ @  &@l@9\@@ "@$@@@?@@N` `@ `@$@/``` $@@m@ N``*p07200@@  @@ @@@ Oр@ |&@@B\@@# @$@@H@n?@@jN```@`/```% @ $@N`@$@/``` @*@ N``(07200@q@  @@ @g@@ OȀ@ 9&@\@@$@$@@@-?@@)N` @$@/``` @@ N``.007200@<@  @@ @2@@ OԀ@ &@?&@`'@d&`h' '`㿠@ ??@@@ \@%@8@?` @ @/```@@`@ O@&@&@`'@%d' h%`㿘@@$`@@/ \@@%@ $@@H@?#&@@8@?N` ``@ 7@@ @@= /` +08:8/`` O܀@ &@ &@`'@d%h' %`㿠@@@| \!@%@> @8@r?`I`@) `@@D) `@+  @ @&` ) @ @ ) 1`@ &H/` @/```@e@`@ Oˀ@ ;&@ @8@6?`I@`@)``@@)``@+   &`?$&@ @ `2@? 2@ /`  @ @/```@.@`@ OЀ@ &@ &@`'@#d%h&㿘@@$@ @  &@@? \@!@%`@$@"@t?N` @ 7@=8 *``@2H 8`N@ `@8@U?/`/``@@8@M?/``@@  Ò@ D&@\@@!%@ $@r2HN`?5&@N` `@ 7@;` ` @) @ H>?&@>J@ `8@?/`/``@@@ ?/``@@  Oǀ@ &@`'@d%h# &`㿠l!l!lp#d@#\#`#h#l@@d#l @#p lh\!0!4#  #t , #x#|##h@ "`#@`M@r' @  @   @K@Y  @@  |@Kv"@J@ !, @@+( *H@@@ 8@KU@  8#l  @ 8!,`8@ &O@@!,@ H`?Dl`@@@?;l@@*O` 4l @ l@H `#xa#txH@@  `@@`-&`?l-t- `h@@@#h@p#p*O\h ll?d$```&@ ' h\d"@ !`ph! 㿀#d@`#p#\d#`@\$@@%`d#h#l @@@   @ @Ǡ #h #l@J @ޒ @@@  #t!0@@ $@ 2HN`?dN`@7 @:   )`@C@B>!, @0 @ ; +` @ !, O@, ">"*`@ @@ @JQ@ >?Qdt2@K?@v   !>M@ `@ `8@<?/`/``@@8@4?/``@@  O@p @  'd"@ !0 @@ !4@J @ p2@  d@ @   @J @d?dl\&@h& %`'@`h'`! \`$$?㿠@a,`@  adadC8a,&Ojс㿠.`!0'@/  4`@@I bx@ @)L=`@"H$ 4-X @ސ$ 4 @ ```@``2O`"@@I; aa@`@ @J:@ - &@;Ӑ@E@ǰ@! @@~, Ŕ?@GX ,?X@ﾒ?@w@ ,@ X@G@G@J@I7G`@;X|0/X (q@ 4 +@% a$@ X|8@? " @  @&% @#!XX,< `?  ”@IV =@ ` * @X @ I`O!X<@  (q@. @Hb;@a$@H?@0) "Р @ @ H.i@(`+@H `@  @ $ i$ $ $.$  @H* ( Z?`@H@@ (@ (@H  =i@HԒ.@Hϒ( ؔ?@Hw i4@H’@ (@ "@@@Ē5XD@Hk@@ Ȱ@,  ?@H =@@@`/`a@ , 㿘@H`X@@H?@9!$* ``$` @`  # & `@   # &` O @p @Gc@@G?@5 $(*  @?J =@  @M`@S?`@ 6(Ȁ(@ @ @G b@ @/XL@@(  @,@9.#P@@ @ , @@q 㿠@G !bȨ  @ @@`@``@$O`@@-` @`h ` @$@@q$@N*5 Ȑ `?` &#%? #:" 30?">`8#2p?"2?`3p?@@H0% ?@@&?-` &@` @&`  o o   '?쀦?'??'? O'?@ '? '  $O   ",%`@%`kk`#쀥@##O#@@ ##`@&O,!?* gx @G   `@,@Fg  $ ,$ %`%`㿠@F; bb̶@ @g&&&㿘@F;Xb|P@-XT\@⪐@g1 " g,`$`@F@ "H`@Fg $`@FX|` @ @Xl@Fg  $` @Fܒ X$`|pI 2@`f " XE" |(  II` @ 'F'`@='``&'`@㾰@F`@@Q @;X|`@@`O`3X|)X<@  ` @ ' ']@* YŖ @_ @Pݐ@@ Y @] @Qʐ @W@@<9X< @6 @ @X?X @X?@b; 'X@Xڔ?X< @XԔ? @Xϔ?X<@Xɔ? X<@XÔ?@XX@X?@aڐ @ @  @"H%   2O  @`f f` f  f & `H@ 2OU& @㿠@E aԀ@@& fff f 2O;F @d@㿠@E; aHbض@e " %" "  @Eؘ  ``@ `2@ ` @  ``2O`@ `"؂ ` ` "f9㿠@E;?`4cж@@) e " " " &㿠@D;?cиcж@@  @  2@ @ `  2O @ &e %`e㿠@@D㿘@D;?ccж@@ޒ @  & ``@ `@$`@x`/ '` `@e @e4% @D㿠@D;?b(cв@@@   @ 7 @@?& " 㿠@D; abܢ@@`@3?X@@ cФ@@`@@E-``@ /'`@@@_&@@O@@E% @@] @㿠@D; `bش@ & @   & e@ 2O @D&`@E!?#&@0 @D@}@E@z@" `@)e`'`#`@1 e`$`!`"@ e`%` @e & @Ԑ @@@@ze&@D㿠@C;?ccж@@@# `'` "@ ` @% @`'``@ '`dɐ`2O@N@,@{@x @Cbܘ"@ `㿠@C;?bcж@@ﳐ2@  㿘@Ca@ @#X}D@CE  @+C@ a"@' ?@ @O@ϔ a@9.@Ŕ a@ؐH 9.#@*    "  㿘@!?@C`4@H'- )X=X@A "@ @ &1X =`@C@@@O@ ;X }@B  㿠@B c-X@?cZ cV#@ &'" %X&&@0?&   " @)? &"   " `@ Sː  b 㿠 @B?b$`@@c%  -X@ΐ 3 a&`4@   ` @ "@` ` @   `"@c~  ` &  @$   @  "@  @ 3 b"@c[ $ &cT @Bb  "`㿠 `b..  .@B2@%c/%`& %& ?&  $@Ahc@@Ch@O`0@ 1@ & `"  @(/@ & "  h @/O`!@/O` 0@ 1@v &  "  @ /@l &  "  ` @@*l`2@   @ 2@ $)`@ X}@  $`  @)"`&`  @@lhlh@z@b`@*Ȁ`@`Ħ ``@Ȧ &O`@    @ &O ;a@h '/  @i  @) @ @ + '(`'@H@  @  @' #@'7  @ + 5` 5`',5` ') `'(`',`'@@  @@ @' $@' 't2@*`'@@ @ ' "H '{`@ː - `" @[`$@j$ @&` &``@ !&!  @j@$ @ @ @ 5  @a$&㿘@@ Xa @& XJ @  X?& X d`"@ `!` "@. ``@2@` `@@ `@`` "H+`(`2@ %`!`@ X~ @ %``(!" & " @"@` X& X`(`@'`@  X``%`@Œ`?@%`J X ?& X@@x@@xw @ !`@ @9L !&!& ȁ444444899P9l99<<===8=T;;<<<0>>2\2\2\2\2\2\>>GpGpGpGp>QLSXxSZZ[_p_`xa0fffgp*8*8,L.x/1%&t&|D&)X'4㽈@?#p#l !?!`@#d ###hd'#t`H@ d _đ,'ldl`Dd@' dl`D@4Odd'   ဤ# bD  0#xb'@! #?#|2`#'< `@?`a \@,*`@h$@?. s'p@ڰ[@ ` `l. `L/ @%  `!  ` `  `.  ` `/``,l+`L.@%`!` `. ?' 4G` a` `@ ``"@s@[  @    "@_s[`! & `.  . `% & ` ` ` ` `.`,+&  *`. % `' s ` `@.  @&s`@[ @&`. &#  `#a#b@O s)` @[@ @ #@$Os 2@@s[ `&$  $ $ @8$ s^`$ $ [#s'@][@ s@>' [#$O,`  $ _`2@@s[ &$  $ $ $  `$ J ` ` `. `, )`@@ & ` &p'*`!@@ p`X @  2O &%sl@ђ[%s p@ [@ % ,@  %sl%@ [ %d&sp@3HG #`#`'`[` 2@s^[ 2@$s# p@|a[`@@@s`[ &`  `     p$a$ @s l@@[@Ѐ@I. d. '`sp#`[@&dp`s@7 a[ @`@s[  b$! `! ! !   ! p"!.  8HDdd sl@ @[ @ .   b'?@" `@ `"@s[  @ "@`]s[` `$`&2O %d. &sp@_#[@d` . d   `(*@   `@ `   `@  `2O ` @  @    `. % $ `'  d ` ` `* `*`(/ @@.`   @   @  2O @  @    `. %&Z `'  ds.  @u[`.   ` "@s@c[pW #`l #\s"@ [@ #~  `2@r   2@n `@`2Hf  ` $ k ` ` ` `/  ,`.`. .  `  @(@s([,'`` @ `'``@`'`2O` sWpt"#\  #`@Ě [@ #!  @  @`@` @   @ `$ .  d$ ps@"[@ d#d@  `$ 񀦠.  "'G7`. ' `@"<7`@s"[57`.   "'-7`. ' `@""7`@s"[7`. ' `@"7`@xs"[ 7`. "@ 7`' 0?&?/  "@s@^[%W#` sp"#\@ [@ #y `2@Ƕ   Ā" ` ` `/  `* ,` ",.  ` "'.  ` " ` ` `,(`.`@ @.  ` ".  ` ` `.  `, "(  . .  ` "@' `@(@s([/ @'@ '@' 2O %W#`s"p#\@ [2@V  # ` ` `( `) ,`  ",.  ` "'.  ` " ` `, `(`+ @.  ` ".  ` ` `.  `, "(  . .  ` "@*`'(`` @  `` @``2O` ' "@a` "@`` `"@Zd` @U @S`@2@Md`'`@@9耢@+@.  a  @   @s[  @ ; b@[-s[`"$` &`` ?&`` &`&`  $ @`2@@@  $ Sd%s#\p@ݘ[@d #9 @H@d` d ``$ ..  `'` @2@`#'?@2@sZ`# ?p@א #[2HHd _؞<  `"` # ` @ @#?`@#"` `a@ `@s[ @   @Zs[! $ ``"@ `"H  ` a. &1Ws=pO[M` ` #@`@ .  . ` @@os[ `"@s@d[p%W #\s#`"@ [@d/W$`psOv?` `#[r@Y  W M`.   `#  @(@+s([/`@' @ '`@'`2O pW#`(#\"s@՚ [2@  #1M`  `#(/`   @   @  2O '    ` @S @O`2@ ` `@E ` @?`#` @0s@: `'`[@!`  `@ ` @s[` @ % `@Ys['`$ $ ' $ @@7 [ @d$"#\sp@[2@d d# @ @?@`@ @ ' ; aG>@.  '? @'  `@ `@s€[ @@Y4s["`&$ 2O ѳ.  `$ hM`@ `M` ` `,  `* ,@ `M`  ` `*` `,`*@ @. M` ` `.  `.`/ @ . M` . . M` ' @ 0p?'(|@ ?|J^``'@ _ w؟x'sp@}[#@Ԁ"@ @@ . . ?'  @@x@@@@Z wإz'|@@ ;?|  Z``'xs@@[@Ns@ #[@_# `" #'   @ 0p?'O_غx'I  @d5 1p?'&ps@R[_ئdz'' ps@A  [|@ И# 20?'[@d&ps@&[a  1p?'Ѐ@x@@\wإ{' `|@ #?| V``'w `s@%@D[@Osؐ @#[@ _|  ` $ #$  @@ 1p?'L `_ؤz'F ` @@d 2?'&`ps @``[_خdz4'&ps@[̐ @]#[@ `d'`ps@``[ 30?' ``(@Ј1 3?  Г4  0? 1p? @ s`@  " [ . @s`[ .  ` ` `( ``* s,@@&,`@  " [. ps'@#[@~s`@1 `" [. .  ?s'ptq[2@ =` #c `.  ` `* `* s, *& + $@pu [2@L` #D `. ? ` `.` `/ ,` ? @!$ %   @  `"@ s@[  @  b "@Vs[$ &. p.s#'@=[@ #`@@ π"@ .  . % `@ ' % . `'?@" @ @sƀ[` @@Vs[# &$`2O` . . ? ?@!$ %   @  "@ sƀ[  @ b "@VXs[$ &. p s'@[2@ ]` #. @ ' `I4 10?`,`s@ZȒĴ@V[@ ``J@ s@5&2 [ 2p?`@52 [1p? ` ```J0 3?` ` &@ $@ %H- ; &@ 'H 4 "@M``. @ .   "@@ M`@ . "@M``.  `. ` `,`, @@.  "@|@M` ` `*` `*(@ @@p. @s `" [Ճ. .  @'''f <@<` @ sKK 4H @4[G  `2@1s` 2@-s@rs'@o'[  @` @ @s @4}`[! 4H@ۢs@۟.`@4n[ @@4H@Q[ H & @ ?@=s ``" [V. 4H @1s `" [J. . <' @s`Kt@  " [ . @s'`[s@  `" [ . . < ' @ @s'[sKI[sp @#[@, @A@=< @@s`JՒ   " [. `@@s`@ @"   " [փ. s`@*00200@u'@ `" [ƒ. 7 `2@@"s[  `$$ `$ $ $  `$ . M`.  ` ' ?"@)s "@%s `@@s[`@ s@[@t[s@ [@ڢ@ڞ@N[@ s@>  ``" [W. @Z[`. w. w' @t@ E `@ ? `|@ 9 `@@ s@_ `[@ * `s@5@T[@ s @^ [@ [@_< @@ `&` #$ `@?&-# `@D+ Ā|@=  T``2 0?`3` 0`|@+  R``%`` @``@   @ @ z2@```@ q"@ ` @ h@ 6 @ 0|@ *s@@[@ s @Ґ [@t [@_ @ `" #"` @t @7|@4s@y@[@sؐ @K[@_!@ ` '` '``  @[` @@|2@Ms"H| @@|2@=s@|@5|@?`?8 `| @"@耤2@ | ?`?$ `"@s@\`w_` `@^@[|"@Y|s@@@? `D['`- @.*2@& s@12 [ 2?`@2@ s@12 [ 0?`s@12 [`s@1: [ 2p?`s@1: [# 3?`s@12 `[`|@| 2H @ ?`? `@ ?`? `?`? `@I "@G`@?# `\ h! - @) @@`4 20?``6 1p?``? 8`# 0p?``<<`"0?``8>` 2? ``; 8 @2p?``2H `< w_` `\w` `>@?&-  `P@e* @_ؘ{$]`_ؖzW`_؀dQ`_؀fK`_؀@dE`_؀@f?` ?`? `@?#4&-8@-+@\b`$`X```Թa `йa`̹c``ȹb` `&@$@%"@- es&@'"H ^s "@M``,. @).   "@$@M`@!. "@M``.  `, ` `(*@@. @  M` ` ` `,(+@@ @. ?'`?@'`# a @ "@s[` @    "@Q4s[&$x. @! `" [;. . ' @2@ ##` @2@s\ w` p@#[2Hd_ؐ" ` $ #$` ` @2@`$ `@@ \`w `sp @#[2Hd_< @@ `  `$` $` `@?# *$@,@ v `  @ _2@ @  2H @  HJ@ >w_ H?2@__>w€__ؒ w w_ " ` 8?!@`@"@hJ .AT _@ P __ #  ` ;? @ ` " k H #;_ 9 @" @## @ 8$@@ '@ 9  .H3 ^@ !6@   @&@ 9`@ " @@ @ "  `: `.H7 ^" `6@ @ ` @@ @@@@  <@_ظć)0<( @_ش** _ؕ* @  <@ħ) , @)`( / ` @ @"_@_؂;@_؀@@ _؀<@8p<ĕ; _؀@8p8_ؕ8P_: `@@:@ <@<`ċ: @<`?<@@Q9`O  @ ` @ @@C @_; wؔ@_ ` @>w__ T  @ ` @@" @9 _wؔ> ` @@>w__3  @` @ H s@Ȑ ``" [R. `@[.  @:w _` @@>w__@ @ s2 `@ƒ  [$ +. `@2 [X. $ ps@   [A'`ps@``[5. #?@|?'  @ 2@ #E@ 2@|\ w>@2@ ; `2@; ?x3s@@[@;s@Ɛ #[@2 _ؘ<# @ `$ #$   sx@ #[@ @@@2@|^|wp@@|@2H @@@"@~p@ "HMN `@2@;2@ ;@?h@@ "@g `s@@[@;p s@f#[@\_p" `  & t& sh @#[@C  |@ @|@@@@ `@2HH:wp `@ 2H=2H #?h6 `@2H蹠?x- `H)p?h% `d$ps@[4|@@|@2Hc@@ #?h `?x `7@5@ 6"Hx[7@8"H[hxR[h[hx J [h [@xhI߃[P `܇ p `@ ;s@[ s@[`d&p;s@ #[@ @I@ "@G `7@ 5@6"H + 7@ 8@ $    $@  :? I @@ #:`@ @:% <J@&H Hs@ѐ[[ @[`@"@:wp `9`w ` 7@ 5@ 6"H_؞ 6 7@ 8@ / _p_؞@ * _p#& _p_؞H ! _p†5_p_p_؊ wp w_p_ h # ` 8? @`!@h J & @83 @s [$ `. ?' @' # a @ "@s[ @ % `"@Ls[# &. 3 s@[`.  ?'G$ a `@ ``"@s@[  @ ! " `"@Ls[ &s `d$ ps@  [. ' @s @_|2@ s @ `4H9 ts@@[@s@_ #[@3_ؘ @ @ `" #"   `@ #[@ @G @6"@#Z  ;`?`s@3 `" [. d&ps@[V `@ Z s`w@2p  " [.  `@ `s#@ [$ Ӄ. @@[5 ` `@ # Ts} @p[.c|d-&  ps#[@d` `ded `&`s& p.  @ b#`[@d` `d`K. ' @@@@k|@@ `@ `4@ Fsx@@ @& )s@ @,[@s@ߐ [@_< @@ `&` ## H@" [ #` @ @;@ @#|@ 2G霪` @s@[? @8 s;?H@[K  @`@|Z`sw@12p [6  4H s@Ð[|`@|@ 2OU`  TP6?H?<H @.?H|ڇ p&`? `s#@֐ [ |2@%   L@?H?H P ?H|߅9h d&sHpL@  #[g$ `. @' ' 4G$# a @ "@s [ @ % `"@Hs["&$ `d&`sp@q` #[ d%sp@e #[ 8H&dd ls@O@x[ "@7t@  l#H@  `@ l#`H `  ` ` ` `, l(`)` T*`  `p.``d( @ s@?$`&[@@?[ ` $$ ` ` ` `,`.`l+ @T(p`d  ( , @ ' s#@#[@$#   D. s p@s #[@>` D:K :`:" 2p?# $O``@  ##,#`` @'D? `?D<` K,@ a@3 @s[b' &" &#  `  ' (.@ `@ `@`2O`"@ "@G/ @B` @@@|@- @.&   @ @s[ @   `@Gs[`&&`&&P`&&&  " C/ d"  ` &` ps#\@h &[@" @ `@s@[` @   @Gls["%d` @d` `@$O=D`# # #$O ```&2G/- ` #` ``&2HNN `-`(`.`  `t` #t,$  `t `##t `sp@  a[ @ @s[.  `&#`### `#p"% `s `. @s % `" [ `S||@s[%/d&`1Ss<p@Y@@δ?/ /` @ۘ ` `#[@p!@sl@[@d$lsp 2a`$a[t@Is l@[@@t.`@@3@. ! !+ b@`'$`? @'  @  @s[ @`@Fhs["`$4O`lH@A `h @/. ! 5 "'%??@" @ "@ @ "@F0 `&h 4Oh@lShH-%@ @%˜S=@@쀦"@dF dh%`㿐@$`cd@@{ @ @9/"  @ @*J`n@N@i@I2@$J`J` n@ N2@J`J`f"@?dF@?dJ`a@A2@J`J`n"@?@N@?@ HJ`3`  `@@ `+?@'L`` ` @ 2O?`+@`-2@L`?@p'L``0@- L` x@ XH' ?@'L`` ` @5?@E'L`` @+?@;'L`` 2O? L` @/`L` `@?@&'L```@ ?@'L`` @ 2O?L` "@ ?@ 'L`` ` O?  @@衐 @???Ĕ?̖?ؐ@G  @^ @?,@/`; #\b  $ 8`@'@/`; b'/%/ 4` @㿠`H@ `,@{ `$$@w `\9 `X  ``??`d# 2@M M  * *+@   2@MM   *`)`. @  ` `2@M` `M` ` `)``*`. @ ```2@H`H````*`*+`  ` @ @  @ &O /@"@ 2H&` 4@  * P#@ ( `@ @%  H@" `4@ #``  @ 6@#```@#`@:O` `4@#`` @@#`@:O`  㿈@#7 ` `@0@@K bD@ @F "@@A@[@y@ @.@_ ?2 @`-' 0&& @r@  @@ @k@ +S@~D@?@1S>|@ؔ? 㿈@"``c/ @?"@  G ' 0@@-   D@2@  @#;h" h;ppƀt@";` `@! @`"|ܶ@  p "<܄@ā @#h#l  h@l/ %  `"   #h #lh@l ?@$  @`"@ @  @ + b@@5 Cw5 @$ %&`x@"``a/ ?-@?@b @]+ b0 @@   bD@ 2@ @   ;pbD@2@   ;p@"o;h" ph;x;xƀ|@"c;` ``@! @P">@  `#"~@Ƈ p#h#l -h@ l$  "  #h #lh@\l  %a@4@  @"@ @  @ `"@B%&  @$  `@`"@ Ā  @ 5 @ "@B$ &&`㿘@!``b.@T"@`  |`5 0@# `@   @   @, % `" a`  @# , %  " U`bD2@.`_`& 3 ` 3 @  , % `" <`@א-S)/@;%/"HP@,?/"\  @T $`DF@!ܶ P `;`  `@4d, %  "  `;` `@d``@'`` @ "@`` @ ) "@/ B/ `'`%`&`㿘@ ``c4.@@" b0`  @ `   "D2@``  ;``@d, %  `" `` ?@'`` @`"@`@` @ + b@5 A5 '`%&`A㿘@ ``a.@<"@  Y b0@%  @ D 2@ \  7;- $ p  @N =PN@ݐ@C S5/>خ@4?//b @Z  `  p  @N#\ \@`/`$  `"   ;` `@d ?@$  @`"@ @  @ + b@5 A 5 $ %&`C㿘@``c@.@"@  \ bD@# \  B`b0 2@   <8`- P  ` L  =p L@A@ S5/?Ԓ@Ș?//bȒ @   @  P  `L;` `[`@D2p /`$  `"   ;` `@d ?@$  @`"@ @  @ + b@5 @p5 $ %&`?A㿐@!`؀`@@@`@@&!@ *  &! @&!-2@`'$&!`!,}_`<`J 2 @:`<`!, (.@/`&-$@*,%@ +!(+  +` )`#@$"@&!@5+c&!#h -   h F;``@ d$ " &` ??CA0@``c.@"@  q b0@@b D@ @])<;h;`h@rl`pԁ @? P, `  \;`[`@V2p =`\#\@*\7` pH?( @0 P  \;`[`@<2p #`\#\@\`@ @o5S-/()/#/@^?#c @   `/`$ `" @$ @`"@@ @ "@ ?M  `$!`&`㿐@````/`'@@I @@ @,@='! / `@&!&!@&! #@2H`$@ &!`?@$`` @"@`Ā` @ -  "@ > $`' &`  SP 4`?@$`` @ "@`` @ 5  "@>$`&&` @#\b@#d@@1\``#` `@ @  L@2@ 7/ @/8cP@Ș \d@@ d1S ?p@\d @] 5  D"0  ` "2@  @`@ #h$h<5 @8$t/ $$+ 2@`]`@ `sh$h< 2@$$$ t ` @ $L$  2@$L$< < ``$O` '   pŀ@h d"@@@$-``@ ` '`@$  `@`@  @ @=$ %@6O`p2@ p@gt``-`!@ `" 2\`@ _@2p ``-`"@ " $\x H`#} p ā @;h`-`h@l`" `"  \;h h@l\"@'H'L@aȪ@H;`@@ `!@M`FPJ@;` "`@$ @ ` p'/30@9S ?@r@@W-0@K?`@@@t '/#㐠~ @@ @@ ,@<4@0? @^@3@l@'?t@ @S@(/ T@,@?4@F @  @@c@@Ӑ@  &@`@.`@-0)0 @0 <#\@ @ݔ@`5@` @VT@Gx< @ @B`@:/ @  X@א"@X 'X'\@f@^? "  @`?@'`@h?@%@b@&@\`@/  &O  `@0p@ " @U@@#\ @n /  @u@`aP@@     ` -+<@_@t  @Z@d @O @^ `" @U@ x @"H/ @  " U @ @-@["@ @u `@@U@ x@@   3  / @' @O`  `?'`@ @&O      @:  "  ,      @`/0@+0@U-ਨ`Ē @ `@ `@'`@z @ @' @q@'bd@@m@  &@ @%0@90ȶ@ 0 #\`  @w@u `.'@;< @^ɒ2@i  @US"@ x@ `2@@8  @@. @ZH. `2@@ @.@q 00!!@9 @T8.@b@ @Z @  &O  @  %0@T0@ @</0@Tt+0Pad@  @@&@x@c@@^F@ @^>"@' `@TŐ@  j`@T@ @* `@d  Z`@   @ " Q`_p___p` ` @   @`x90)<!  @<@ @6 @  "  @@#\@` <  @@ @ۺ  "  @@#\ 0@h`@&2@ 00@-@Y1@  ꀤ`@ @ @|)0@x!#` `$#\@>Ѐ`@ `@ ǀ``<-&`x @@h@Y@{@ @J @c  S" @?@e@ S@?@e R< @x?@d@d@d@ܐ(`@$`@ @@! -@-@a8@@a0@@X@@ @@Xǔ@ @R"@?``@  `"@f 0b<8x<- @@@Y5 @ $` @`"@   @X@ `@ @R00(b8@o `"@.0L@@b @@@0"` @V @@ @'0h@J @R+0bp@A @ `?@&`@`@ `@'`@㿠 @> /R@ `t@@@FJ -@-@@ @7@    $O  &/ 'R@0@%@H &@$`5090"t@@?@ &㿘'@V`@0@@J ~@`@&@@\(@ @V@ @c @@Z\ 2H'2@@$'` &`?@&@g㿀@'?b8'`@@ /R   @c@[ݒ@ @Q֐ @S@I`2@@Q@ @l50@@QÐ0ⴐ @z ``#`@c@Ң7֑(@ @ct@_`%  @&O-``&@7 @a  @+ @'@c'@S\@  @c  O  ?@%@@ `2@4'쀤@ @`0;0⸨bȔ  @ۘ jR`D@O @ \@S@ R @L@ @ 00"# @ ;`$@7 /R `L @ 2@& @@R2@ &O -%0@@+0Lc@ @u  ?@7@@&@,㿠@;?aPcԴ@@p  @/R &`T+8@?&` ,㿠@;?`ĸcԶ@@M  `?@&`@&㿠N @`T/@ޠ@\@ۀ@7cN  :@2@SN `/@ `\@  &@և  N @ /"H \@  O @ /G \"O &-R@k А@f c@jC@hl@FL@Dp@0P@.n@N@a@A@ N `u@`U@ N x@X@ N @{ o&N u@U@t N l@L@n N  @i ]&N  r@ R@b N  n@ N@\ N `@W K&N  p@ P@P N `t@`T@J N " 1`@E N @ 4&:@< N @7 +&N o@O@0 N `m@`M@ `n@`N@& N @! &N #`1@ N `@  &`:@ N @  &@֎@ɔ &N  /@ \@%R @x& @հ N  /"H\@ M/G\"O@ M /@ \@`M` O /M`@KN @G@FN /"H \@  N /G\"O @ N  /@ \@`N O /Rȸ @a @]R<̐@W @SN`/"H `\@  O /G \"O & &7RĐ@: 㿠@)? `@WQ" `@&@i㾸@'bD@@ڒJ ~@`@M `@  `/@ $ L `@`/2O $&`; cH`@ `H:`H/@ `@ &&` '@ '?Ԑ @k  `@1  @` @ '@n  @ '`@ @_  &`@ON /@K"@ @B&J `@   :`/2@` .``N``O`/ @ @0N:@,@'&@@%RԒ@ @dƔ @`@ "@ &`@T &  " @?㿠@; ccH@@ H@ `@@`@ڐ@`@Ӑ@.`@ @`㿘@? `" @Rb?$@ @R`@  @_@Ē`@  O(4@&`@ 9,`+  @ @_ @ @r`O@  ( & L @  L @ L  2OL ```@ &O& ,`&`@'`@㿠@`h@@N /H %R ب@  @_ L @ /@  L @/2O $@ M `~@@ 3R|ܐ@m @ @d @^L  Oը@c<@@J'@I(( @ (@>, @^@)( @ L @ /@ \@ L @ /@ \2O@#@N`~@ `  @N`:@ 3R|@@  @ @ @^L Oɶ㿘@;?acԸ@@ @~ `@O  @~ @i@ @ R<@ʒ @  @@D @^?@p `@  )@d @  @X `@  @L  @    ;R@>@}$@| @  @] @_ :2 30?@SO`@ /@ `O`@/2O`@@= 2@NN .@!%R@M  @]ΒO`-` @ .@ ~N.@+R|@9  @]O`` ~@ 1R<@+ @ @" @]O``OO` ::"H`@@5&@@RN``:@& @ `@]}N` :OM `~@  @ݒ /@@ @]d`@̒OϤ&@M `:@ `@"@ϒ? @]PM @"H~@ @ /"H@? @]6㿠'D@ @\ `D@\ `@ `  @]`$O`@S?@&@}֐㿘@c@@~HN`@! .@ N` /@7 N` ~@- H @  @`@ 7 N``:@7 N`` @7 H` @ HN "H@@O?/@ R @ `'@ѐ@@}ސO` @%  / /2@,`O``/@ ``O``/@O```/"O``@ "@ `,```` `O` O‣ /@}$@'@l@@K/@ :@ R@v `'@@T@}O` @(  / /@ \"@O` -`O``/"H``\@ ``O``/G`\"O``@ "@`-`O` O߀ /@}i%'@!@ :@ @ /@ O`@   :/"H*JO/ $@!O`O` :2@ O`@S@N:@!`@M?:@ @R}@ `'@ :@ R}@  '@@@}  N:@&@}@ N`:@@@N` @  / :"H.`N`` O :㿘@|1 @`? ?@* @[ `$O`$@Ro  " @$@|^@|ܐ@ @% @|Q㿠@a@@? `" @U@  ' 4@0 @|0 @ސ@|@? ?@' @|`'`@- @|H @O`@  \/"H/`O``O/㿠@; `cH@`@ `H `@ -@ /'@ :@@ /@ :N `@ /R @m2HM```O@Œ .@@8H N`@ct@#@%R(@ ' @=(+ "@( ';0)0@hcX#x@  @@ "@ @T50/0㘒@  L@d$8 L` L L L L Lt L L LL L L L L@   #\? @ -`-R T@ cL@@@@ ߘ @u@?`b@@Y*`@ T`@@@ `J`R @@?@ R =\@@?@ #\0`-`@@@ `$`/R Ȑ@ @?@R}@ @?@ِ@@@Zl2@ ``@O-`&7R @@o?@`&@{2J -@ @&@ #R ~ @@ @ @ !R >0@@D?@ H@ @ H 0 @  )0#@ #@-0@ @s@z@/O?@ @ ' 2OO?""@X @  !@ '@@zR~l@;@@' @u L@ 9 @  @? L@ݐL9R >p@ @@R~|'@@ْR~x@ @Ӕ @ϔ O `@ @O'M @@;?@΢ @`  $ @ -`5RD@@Y- " " " " @'H@YSH@zZ@ 2@R&@@ &2@D`&`2@BD@?O !H"b`@+` & &`&&{&v`&q&l&g &b @&]`2@ H`@\H&H` #`O@Y  @ZD @W@H@@Xٔ @y@R@ @@HH@X˔ @y@R@ @ @H@X @'@&@`` `@y@R@ @@!H@X  `@@& @"?'6OA-`R ~А@@ʒ?@ـ@QR~ @@B?H@ˀ-`\@L L@ @̪`@yt@̭@`@̦ $O`L@ј@ @ @@Xo"@ `@0 @ @ L@ @ } @) l@_L@fP @y&@_l@@  `@O@6@2 R` @x@s@B &O @ ;@@X@ 0@ *0Ԣ@@``@ ` ` @x @ `$O`` @u  H @ېL @  @$ @x.@`@`@&`@x! @@$@x ,k@ / `H@` @ H 0 @;0  0c@˥,@N`c @@  :2@`@˔,N` ~@V0@ˋ,`@x9J ~HEM@,\@ M @ j"H  M - @ b@  M O퀤\- M - @  @-  @-  ,@@@T?@@M? 0@w,@E?0@ ,@I@ #@ @ ,@4M O`@"H @ " @A,@@ @b@_ ^`` @ ?@$`@wP@wk " @($@V' (`@A@3 $  @w @N``@ R@ Ґ@ R @ْ R @ђ @˒"@VL(` &O$$ @@V=(&O$@`?@$`@v@˙, H`@&  @  @ `{J`@ H`{"  @`}  @`\?3` 2?`@H`O"  @ cĀ@@   NL # cH`@( `\@ L @ I@ `@ A@`"@L \@@M@GL  `O݀`\``@`@54'N`/@@@+:@)R?@*"'@ @:@R? @'R: "H@ @ O'L `@ `@`\ @L@ ߐ@   7`@ Ӑ@/L{@}"@ 31'L`O݀`n-R`$ @є  0'#"H91 `  @   `@<(@ɪ('@@ɱ,@@)-71H`'@`@]&@ɗ@ɓ?(@ @O` }'  }-@eL@ +R , @ * -R( @  "@@Z? `" K`@ @ސ@?b>' ' ' '$K`@S  " (@?j@<, <@U@3 @0 @T۔@@u@?``@ R0 @R4@ @@ OՖ`?@'`@u5?@%@u/"@J`@ _` @ "H "HB]@ :@VR8@ŔP@N \@ /N /@ \"@+R 'RH 'R+R<@Ȭ@@ȥ'N@+ /\2@.'NO\`@N\@/N`/"@R R@ RRD@}H@v@h  " @ @>`'`@ @t㿘@'c(@@F`@@tJ `~@@&@t@N@ @F @?@Jv'! `@/1@JF @  @S֔  /1+ LcH2@`@ '  "  @&@tD ( 㿘@a@@" @ǔ @@$ @ `"@0N@(&!   @ @/ `'N`@ ` O "@$ 1p @1 @˱ & @71ऐ?@ @ϐ?@L  㿘@`$@@l" @j @@$ @a `"@0N@(&!   @ @/ `'N`@ ` O "@$ 1̐ @Ԙ @T & @71?@G @r?@  㿀@9b @@@ ;`" @h@9`;h@;` h@` D@ ă BP }<@ B`L "@/ #p#tpt L `@ `' @` @  'L @ `O  "@ 1a8@@\  > 㿐@ N`a(@@@` .:/` ` $OM`-@PO0@O`@d & 1@O@Z & y@RL@@K & n@  RP@t@> & t@ R?T @f@/ & f@ 'R\@X@" & o@` @+Rd@H@ & /Rh@<@ & @ ;1a`@Ø  ?@"  @"  " "  "  ="   " ?@  @" " " $" (" ,@" 02H" 4㿠@ (b`@@) #``@/ ㄺ ``@;  4`cl ` @ `@/  % $-- ,$@+  *"*`9`  $` .` $ $,` @, @ *"* @)`!(@; @(` @`"@$ `@@``2O`  (``"@ `2@``@@``2O` 㿠@ (`@@ c@ ㄤ  @%  4l`@ @@,` " $/`@*@ * !@(( @+@ = @  $ @  .` " $*` @)`@( +@+`%-@=  @-  "@* @ @@2O & "@ @2@@@2O &&`@@&% " && & &@&   `& @@\㿠 @`(a` @@ 㜸  @ #   `@9 `4 #l  "@    2@  `$ `.` "@`$* `) ( @+` .%-< ,`@@+R #`l`2@`@y``@` &``'` `@@%㿠@ (cȀ`@@ #@ `@ @   `@#  4  cl@  @   "@  `@@$ 2O   &O @9$֐?h3@@& ,& 0"` "`"`@ `2@`  6@  )  @ " " `"O`"  ??h@'5wؚa'@w'w'w 'w @/  ? `@(````@` ```2O`` @(` #h#h@  !@ hЍLD NJO݂ ;`!R #̐#?@S@H`'R;``@E@:`@ $O`-R;` @5@*`9Q@<;hh@*l㿠 (.` `*H #`@M`@  %: .`!@H `@o`m```%%%O%`@-`%`4O`@``o n & ?&?&?O&&@ `%`6O```( @ `` 2@ `? 2O`  ( @% @``?`` j@ ? @ @O@ @  @  `? ` 6O`㿠@ `*H " @ȒJ J`@ @ ``"@  K`I ` @O` J` @  K`* ` @  ` K`*  O 㿠@;Q`|@@@wq 㿠@;Q`T|l@@wa 㿠@ ` /`& @"/` & `@`@n&&`&O&`@&`6O& $  . (.`& & & $@ `@ # ``@  4`cl`@5 `@-`$ "@ ` 2@`` $ ,. " $* * )  (`.#+`= , $` %@ `2O` 4O  @"㿠@/ ` a㴪@@@``@ `2@#\`'` #\ @㿘@/ ` aL㴤@@``@@ `2@``\&` ` @@nf`@ L  ?*`L`:@ @ L`M` O  \` @`O*``@B L @@ \` @ `" @  @! &` &`" " " '  @~; a 2@@m` % $` $`$`$` @@91!l9@_# a `2@ @md ` % $`$`$`$` @'1 @D !2@@mI` % $` $`$`$` @h'1x 1#\!#`@@ `` @  @@ `@  2O 㿠@a@@j;Q|@^? 㿠 ?`? K @i  @d& & 㿠@ 5 `خ@ ʐ @M &`&`  !F㿠@; `ha@`@+ @l`b 'Q%1'`آ&&&& @ϒ@?`@Q3 c@%   @@ :`9`I@@  @m @ `@  @$O *   @   = =`K  @  @@l@ @@ @۔ `@$O  @@Д   @ˁ㿠@9QbP3@< ( & Β `8-ʒ '`x`\'`p'`t'`|’  ܘ   㿐`@ a`@@%Q@th 8@  ``2O U |`@ p%s(@5Q(@tE [<pH<\8 D 8@@`l@ @/Q  1 ;Q#̈~ "@ @? c@@Ʃ* Ā@3Q@o@ @ @6@ @l J @ @@Q@P@ @kJ H"H  Q   @#\ @@{@ @@ n@7   @,`@kJ `-@ HQ L 2@N 2@`  ` @ @@,`@`@Oۀ ;Q~T C @"/#Q~hԦԒ@y @  @mސO @?@@OԀ"@ ?$4@ @j @ $@  @"@ @@ ` p>|$O @@1ᬒ @.  @ /Qt ؔ @t@  @p@@  @ @} @@n  @ Q  @E@  @n@ Q~  @,@  @Ր@s@ @@f@ @@Z@m  @#  Q>Ԣ  @jJ -@ T` 2@8  2@ ``` @&O`%%@ Qܐ  2 @ΐ@/` @ǖ@ /Q  @@ @% @ Q  @@  @@@?  @U"@Ͱ (@"@   @o @HL2O( @ Q?  @Z@ @j @  @ @ @D@ @  @ !Q?4  @-@ @i `  €2@ /1%1@31@iԞ#\a@  @ߐ"@Q @"@91@i 11#\" !@ @ !Q?@ A @ݐ@ @i @ / @ @ @ǐ@ @ j@ "@   @  㿠`@`@@@9Q`d?\@  㿠/  @9?`? @%`` ``" $O` @r " @k `%#\@6`?"@@h``$O`@M `" @F " #\@ڐ@%@h~`?@'`@hx㿠@%? `" @? " #\@?@$@hW` @$`@hP㿠 @ଐaܢ@ŀ2@ ;1@z1b8"@@@ @  @&@ @h &@`' @.@'`   @hv```' $O` 㿠 @ଐ`Ȣ@ŀ2@ %1@51LT@@ @M  @&@ @hC &@`' @ '` 㿠@9c>@@"@ 3 @0 @h@UB  @[4 "@2 @2@+  "O @ސ11@g )1""@@@  @͐#1@g b` 1@ "@@ߘ 㿘@\`"/`: " ` $" " "  ' @7  @$$mm` `% "%  ! %` %` O"@` %` `" O`@t@r@g >|$$ F@-  ?@%@g   @' @g`@ `&@ @f``$O` & & $& ( QB@@ `Ȩ`p@gD@@  4@g3@`"O $ "   "  " h8@ % "Oh" $ @@D@B 㿠@`c<@`p@f<2@ -1)1@͐@f"ؔ@   ߐ 㿠`@fٸ`p < @  @D|@k 㿐`@`p @   @E2O  x  ` @ / ؐ@/  @*@`@> ,`/ @~/ +`@x@ &` @&o!  `%`? $ ? "?``O!`@   #$O @@@@u@``@ &@@e``$O`؀@ 㿠 @&@e  @   `%`@@e   &O    ~ 㿠@T?@ @&@e㿠@A?@A @&@e2@  `p㿠@@ @   p"@ ( `@"@ t t t@ 㿘@a@@D$@  @   @e@ ,@    @ `&O  H@Z51@ey11@#@@m 㿐@`Ж@@Cߒ@|@@eW@B`?`@$`@d@ -@@e:?2@@ڐ 0@@@311cc @ 6 /+}&x&pp&t!Q='` ` Q' ?dt @B \@ &`\@ "H @ @ @  $l4 @㿘@bh@@)Q?@l@ P| m  ;P,| "@ @?` ,@-`@!@@d J `2H @#\ 1P<  ' @   @ -P @  @`@ P |P @ɒ@  P @h@$  0' 0㿠`/p`@ "@A @2bd0@ @  @="@`  p S04@$ < @   @@ @&@a@ @}@a&@͐ a& @Ɛ㿠f@ @㿠``p"@$ 0+P@~Ha@k 2@ , ŀ 2@  @ ѐ@ 0' 0 㿠@N``p@s@,N` t@(PP@9@!Pߐ  >X @.@'PԐ  `@#@  ǐ  @  / ,@@ 52 @  `p@` `&㿠@;?ccخ@@ W T |' `' @ ' @АJ $ @$  P~h@f$ $ O P@Ȓ @  $   $ $ $ $ $ $ $ $$ ( $ ,$ 0$ 4$ 8$ <$ @$ D$ H$ L$ P$ T$ X$ \$ `$ d$ h@  @  $ 8$ l$ p' ' ' ' $ t@N` 2@`` `@   `2@``@   {``@ `@  l㿠@;?`̮cؠ@@O  @b  l l@ t@X l@2Ot @ "@\ @2 2  @   @h%h@ ,@%h "@A @ސ'2#2a@  @L @`P& L`'``2@%LP'`%L%Po " " " " " " " '`%l"@ @22`   @ 㿠`l "@_0@!h@&hb@@ ѐ@&h "@W @92!2!!4@@@  @L2@   `"@&l&L &P ' @P%  &P&L' ' @  &l& @ ' (ƀ ' @ @k "@ @* `@ @`2 30?   `l  `x  `  `㿘 `p  $@@&㿠 0"   " " "  @ ` `@@    @  L`2@ H" L" P @ " H  "@   <2@ " < "`"`"` 㿠 @`@ ` & @Ȕ  @`2O` & @& D㿠`;"@ @b@@*   "@  528@  㿘'`@  < `"@ @`` @  @`@@@ $ !`  @2@ < <$ @$ D D%`  < @$ D$ <@  2@ @g@O` `` @ @02@' < @@  ,`@$ ,} <@) @@)@ n <  2@' $ @;' &@ G  $ @ @$ D!  < @`"@ @@  $ ```  X @ 0@ @@ <"@2@ @?㿘@;?cd@cؐ@@ @  @  `< "@`@$`<`@@P~@d @`(@ `@  /  @ @M @ `p(@ `p@` @$```8 "@`,$`8`,2H@ @@(ސ@`d `@  $`t$ $`l&`' @~# @|' @~ @~ 㿠@;?adcب@@u   `@@`t" $t`@``t@ `@t2O`@3P~@ct'`t$t@@ 㿠@;?``cت@@@4  t@3P~@cZ@ $t@% $xې@q@ǐ 㿠@ @c@` 0 l`@+'P,@c+ @ "@e 32ad@є   ' `@ <@@  @ P \`' @\ @I 4`@ `' 4``ʐ 4`2O` # <,' @ $@@'  `@ (ƀ  a'  2 5 2p?10?' ٔ 2 2?㿠@;?acض@@  `l@`d` @ @"H#   2O `T @  g2O $`T@`h`\$`X @  `@%`@Y Q2O $`\㿠  l@  @?@@7@㿘@ @ `@?6@ @% ` @@']㿠 @  @?@㿠'L l6@@'L@L@]KLL@1 @&@YL@q㿘 `l@  "@`? @ *@@Y@U㿘@I    < 2@ `$<   @ '@@'  *`` '@@'  '   % @2@ ?&@4O<8  4 2?@ٺ #t #x  ##|#p8`x'4H'@ p`-  't@%@'#' #@@t@x@#t"#x <2@`$<@ #@@%% | #`#\ #d#h#l˚ ?@3$䀂@ @! %@ @"@ @@%@Z@G @ !@'2 @;'#tx& #t #x(@ %@@#@@@Ɣ%@-@  @"'5 3?4O<x4OF8?`H@%ߐ ?   @  "H "H  @"`@ :`@ @ @HW "`@D"H(` H1` 10?(` H1`` @2p?(` hh0``H @1p?(` 1 `H @0p?(` 1 `H @10?(` 0``H @1p?( O܂` 0`` @2p? `@gH (1` 0p?`@*OH"@V"`@F"H` (1 H 3p?* 0I 20?i`j`*  1 I` `10?@* 3`I` `0?*`  0I 0?* 3`I  Oܑ20? * 3` @ 0? @@ H (0` 2p?`@*OH" :@3"H @( (*OH" 4H  @H ` @@@(`H ( *OH # "㿠  @@ ``@@' `@@@@' `@ @@' `@@   @? 㿘@V@@@W@ǐ @&@WX@ `@ l@ @p? L @Wh  @    @5?!P?`@i 'آ'#''''`'w''Ԥ 'К $ @ @E@b'Ѐ`@ @H`"@`@ *OH` 'Ф `@`@t`"H ׀`@`"H# Ѐ @̆#`N @ (ON À @#`N ` @ (ON  @N ` @;  @3`'Դ& @@ `'а *H$N   L%`` @  % @% 2O%7@' ' @a ' ?N @  *ON m&   @@2@' N @+ ̐#\ #`#dsh  Ȟ@&И& ''!@'@  Ԛ! 'Ѐ @1#`N @ @  (ON & <  @`'԰#@`И@ @   # ' %K   "@#  # 䀤"@  '  ' `'  "@ ' `@@-  '  #l&#d #`#\#h  $`&@@  w' & ?@@@ 㿐` ` `"@` ```@'`&@ ` ` ` ``@@&` ``&` `"@ ``&`  @ @ $ &`&`?@@j P&` ```@ ` ` $&@`*" !`@@- @A`&`@#` ``` &`#d #`#h#l#\` { ?@($ `` @ ` @ "O '`&` ` 2@` `'` $ P`%' @: %' `$'`&`  &`&`?㿠 ` @4``! @@-` &@`  @$@ @@ A2@ `&` @`@'` &&& &'@&`㿠 L@+@  ”  2O@$L @ @@ $  @Ŕ$$  2O$L$P`@㿠  l@| @?@㿘@ `@o@?@J &@Ԕ@O b@7h@`@3 w'    @ 6@& '  @    ' ' 6H @ $@ h'  '@!?㿠  l@ @@ 1?@㿘 $``l'@@ '@ @T:'NHIs@< `L`@&@`L``@ `  $`L`"H$`P`@O怢``w$`[@ `"@(@ @ 7$`@0"O`L 2HK?` 7$`@C@T @8 `L`@@`L``@ `  $`L "H$`P@O倢```b@h@`@ w$`@"O`L @?`$`@i@ 㿐 L``'@ݐ? @@ @@-`'@'ݐ  @@`' ) @$& @K  @ *``' '@M@`2@`?`'`@& *``& 㿀 L@`l @@%@8=``?K =!@ :` @ @- $$ @@@`  @$ @    ?& @@  #\#`#d #h #l   & H ! @"H2  #\+@#h#l  #` #d&   @  M ` @$  -   &  &"@  `&  #\#d#`#h  #l ƚ2@* @ `$@? 7& ? @@!P?l@ZÐ@ "@% `@勔o & L@'@e @2@& ?#h #l`#\#`#d  z@F  @@@%'@y& "#l#\ #`#d#h  W'@! "@'  & @ $@, 8`@.H ' &㿠 $@    @  N@ '@`@*OO`  4H'  @@TH@@H#@"@|@ݔv`@@Ք@@:@lN` ` "H.``@*ON`a`@"  # M @*@M &  2@- -   -  *OM%%9`  @@ @ N` @(@ &  @ #M @*@ M & + @@*H`+ + *OM%#`@& @ /$  && .& &  '   㿠 ``l@ @dL?@J%` u%`@3` @"' m` @& M, & M+` & M *`  & MO(@@   & M`@,$O `L @& %`L %`P"@& & `P ` %`P%`L@㿠 l@ "@<?@  @  `@&! 2 30?㿠 L& L`@ & P` `2O` `@  H @& H㿘  "@  `"@PL`@ &L &L &P& &  "@ H  @ H @ &H `?@ 6@ ' c` ' P @! &L&P" &P"@      @@  @' & @ & &@ @ h&'@ h 6.p @s`@ @? [` s`_@?  l`2@[`@j ? s`@C@j[``@ @@Y ?r @?`" s`!?5  ! '  [`@ s`s`@  @V[`'   @'  ' s` 0 @?4[`s`@Ȓ [`@ `8 @ 2 2`*0  ? 1`` O'?sh:`: `sh@[h@ `' sh@ > [hH ? ? 2 㿘 @m @?Q @?I`l @@ɐ ?>@@ʐ@ "@ @ ?. @W  "@ `8 @     2`*0    ` @ : `@? @>!@ >@10 㿠>`3 2`*0  㿠2`*0 㿠 , "@ @l& ,?a@`@@ h@5@@@@Z ?-@@@`@@@O ?2@ d@; }& -@&  @? ?㿠 `@ "@  @2 30?   ` 1p? `L @     @ #     "@ 2O `l @    @ "@    #@ 2O   @`@ ` `` `@ # ```  " `2O` < @  @@  `@!     @  @ #  !2O㿠;c@ 8&` "@k&8@  @`֐`&8 ``@T@,`@@, P?@?@N`@ PԒ @ @?($,@@!P?@VR 72@~Ḑ@} (?'(@ $ @`@} (@&O$$,` @}ߖ @K$@9  @`c,@"@l h "@ 2@  @ z32@ϐ@t @ NbH8 O<@@@ `92!@"@`@ @% N`b@%O@@@a @~3ONb@)O "@ ,` @G7 2@ @/2㼀`@` @wD   @\"@% 2@ @2O @u @GT J @    >㿠@ڸ`(@@ ``h@  h @! `  "@L @Ĕ 2@ @@M `@J 1 `h@a  h"H` "@k @u龐22c@   H @ @@ @@  @@5  2?@ @@ @0  1p?@s  ` $ ``(4`` " " " " " " " " @ ' "  $`h$ h@"@ !2@u52c#Ԓ @ 㿈@ a @#h#`#d   #\  4 0? 1p?``@@   @E "  @6  h  d30?#l  $  Ւx , @, @Ā@  $@''` '`@l@G` `@>`9 #@3?@-`@ -H ̀ %@@` l Q`H` "@  $ 4@ @E `@'@F!@@bl'`l`'@ @] ?@#&  @& ߐ2@ @!`H`@ `@B`  "@Ǻ  ?$ 4@º @Ea @ 2O\, "@a  $ 4@\ @EN X h @` ٖ "@  $ 4@ @E8 @$,@D`53E\93@Ɛd ( @}  @$,@D,\)3@d 3` @c @ ` ?@$ @D`2H\ @\ @ `@  \@u@t&@HV\ @s2@ @k @D " @`\@g@H@#`@\ @#\@ `\ 6`?@%`@D\@g>㿠 $@1 =$-$@" &@$2@@@@ $@ O w@? w$㿠 L@ @װ bP@@@"@ ٲ @"H9Ҳ @ @ @  @ג@& $ @ @  @~@@&N  "H.  *ON  $ @'  @ 2@  . 1  -' @ @Q@&:@^%@/?N %  2@   ' -`@@ @' -``2@-` ' ```@(ON`%@: $@ @ @ @@&@"5?N $ ` @ `   ' ,`2@,  H ,  ' `@(OO`$ $@`@ *N ?` @  &ON   &' ' O~@K@@@  ' L @' P樔 㿠 2@ @  昔 & &  @@֣&@  & `@&  { 㿠@ @  a `<@  `2@`R``$`<``! @4H` `@`@S`"H@T O`@`"H @M O@@YI``@Q @>O "H/   *OO 5`   :HN` @ @ /   /  #` /  `` *OK``'```@@E@`2@=0` O0@KE O>h@KA`@'```@2@1@` H``@$`@@`@ N` @ `@&OM&@!`@$`@` @ `@$`@@ @&&@ @  2@ ?&4OS`<8㿠@K @` bX ```@ @5 3p?@X    @@ ` @0  1p?@H '  0'  @+ը}x   @/լx `@&@B# &h' hu㿠 `l@@X"@  "H @2O 㿠@Ր``@ْ@ "@ @/3,@@r  2@w& `&  @㿐@;?ccظ@@ @ 4@p@@c`@7?/OO> +O~ ``l@ @`@@ `@ @`@@ @{<@ 2@4 2O -  'OO O~ ?`l@2@` @2@`@2@@{@ 2@ 2O  㿠`1O@`p>a@ם 2@ , `2@  7 30?  `0:" 1p?㿠@;?a<cش@@k @d `@-`l3O-O)O~Ġ> @ @J  @ @ J  @ @J `J N @@K"@ `t`2O`l   `@` @  `"H 㿠: >`#2?`㿠 "@  ,  (       $㿠  2H 0㿠  2H 4㿠  2H 8㿠  2H <㿘@Ӏa@@'3L@.`+O@@~@ӕ@3 TE@@<"@v  @A拒@M)O?T HE @ZO@@rO@g 2@ @@i @@` @;O@Ӕ @3 3@@T2@ H %3@p  B@ @ o13-3 @o   3`l@o  >   ǔ㿘@Ҁcd@ @%O Ҳ @?৒2@  @ -3А@o  @ @ 13;3!` @o 㿘@Һ&b\`@ @ O  o @?d2@  @ 3! @ow  @>?@%@?@?`?@$`@?%@o@ 13-3!,<@oL  @ @ "@ `?$`4@ @? @n>@Bn @m 㿐@Ұ&`x @@@?H OL@=@@    H-O ?4@@?033@H@@ @n  @?"͒2@ @ 53p@@n  ?@,', @?-J  @ ` `@  @B'@ OX@@H 3  !@@n  @>( " x @'3@oA@ #3ḖaȘ@@ @n ?& 4@  @>T @`@ @>͐M @@yc@mD&`@ @>8㿐@Ѻ&a`@ @Ox 8 @>- 2@ @Dn@ @ _%  Oxϱ "@ _-``2 2`*0 h @ 1373!̒ @n 㿠@@1O`?@ ܔ @>&Ҕ @ @li2`*0 @Cߓ2  㿘@@1OcL?@ Ю @=ޤ @ @ @lŐ@>$@  O 2@ @x @Ѐbl@g@6,&`H@^-O@=i @ %,@=^ H @,@, @@ې @ H,@ސ,@=@@Ð @͐ $@!  @=v@=s32@  &O -O  㿘@@1O`t?@  @=B@ @l,@= H@Ϻ cԀ@@' 1N' <  @=J -@`\2@ʰ  2@   ` &O`/NH ./N Ϥ  @<J &@&J  @#@@+D@  ,$@#&@/-$H.,  -  @< $$O , @$@@P @@ "@c @{2 10?$@@Pז @@|@ @; 7 @? @@l@ 3 @l; %4@& @; =@k7@?@  "@ "H  @ 7N\@Cː @O @ ۖM@ke  㿐ʳ@  '`ʷ2O Zp㿘@;Na||@f @А 8)Nw %Φ< 0ƀ@1N<@Cn%` 㿠@;N`D|@5 @  ,ƀ@ɣ㿀 `"@: @ /3cЬ@@'3@]@]#3@8 Őb<#d#\#`䬚@ #" @],@]*ρ㿠  "@  @]j Ձ㿐@'b@@m@  @ -`- 1N=    @@:@J -@} 2@  @ @ "@`[N @# "H;TN @ S`)3"D@jh  @@-`@:C`53p@jX  `@@-`@:~3b@PH+` #3b@j>  @`@@ -`@:b@`93" @j+  ;3bĒ@j#  $`@Bk@O-` 2H x   HD@`@ 13#@j  @ @c-`@:,3Ē@2@k 퉐 @ 턐 @V ' ' |@@ ͐}&@.-`@9`@&+ @9 3Ē @"@ @@ Ғ܉@i  @9;3#353@9#\c@cd @i㿐@̺a`@u@@r@qN@9N2@ @@hq33cԄȒ@@@w  @922@  @?@hU13 3#c@ @@wl  '@,  5N- @  @ʩ 2@(  @ "H  @@@N>@ƶ@% `T@ N>$ @ƪ@&O`@ "@?54$?@ck  @И@c` ~? @Ɛa<@@ @ @2h@ɐ?@-N@ơ @ @3h)4@#4aX!@@c, |`,@~!@ @c@3K@44ata\@c _`NN>0<?Ӗ @@3& @^4x4 !@b 9`@ 2` d& `&`@3#dG  `@ ` @$`@2 @& @\h`@@2/N@@  ``@'`@2t㿠@ 㿠@" 㿠@Śb@@@@P @M @ ;4a@c @; aд`@@K @ "@ @22Hx@: x?@O@+@'%@2#@@%@2 x:`&`&`v`&`&` &`$&`(v`8&`@&`H&`P@@  , @v ?㿠@@ `l "@`,`@@` ?㿠@; cȴ`Ķ@ @3 @ "@  @2 2H @" @?@ 2O @ @$ @1 @ @$ @1@@ 0 @ ?㿘@9 b Ⱥ@@@;@ "@@1 2H @+%@1S( @$  @@  2O @@%@18 @e@a%@1.@ Ē@ @7@; 4 @7?@ @<@9   2`*0  0 @ @1^!4!@ 4!̐@@a"  - z  @ @1C34{%4aТ@@@a 㿠@@ <`@@?@Öat# >@ÊbԘ#l*`@>@ÊbԘ#$*`㿠@@ H`@@  㿠@@ L`@@ ?㿠@@ P`@@ ?㿠@;?bcܶ@@o  @.@] `t @@ 2OM S @ `@'`@0$?@:&@07 @/ @1 t@-@&/ @ @ @ `@$`@/  Ԑ`@$`@/ @$ @/ Đ  @ &   @ u@k ?@2@ x#?`@ h@?@"H y"@?;<7@? @??   @ >@4 ?v㿐@šc@@@p@"\`"@`@ @@' "@ò  @'` @@/#4 4aa @_  @42@`?$`@S@@@@@nN~`w@h?  "   ? @% @/@_#\#`"@ \@`@_$`@/`@@` @$`@.$&` ⺐   ̔ @ " " @'`'` '`$@ @n'`'` '``@$`@.ϐ$7(&` @]`$` 4@ @. @P`$`4@ ?@.?A ?㿘'`@@`2@\ &`@' @'` 㿠@ "@   `2@`\@8 @ Ɂ@  ?@&@.i ⽁㿠@w@ @`@@  㿠@.@`D@@  @ D@&@.: 2O㿐@;>axb@``'`'` ''ߠ @' `̶@8`@ @@- @` `2O`㿘@`@@Ր@` @ @ @S( @  /@ /@.6J @-@.0@g| @ L @ @  L @2O $@ O `~@ 1N>h@@g] @iߔ @gT @ ԔL   O׸`@  @ 1㿠H@ @ 2O  & `@@ 㿐@bh@@-#@[/  ̦@@@P`D`@L@@G @ @?'9``@3?' @ @-@@Β@` 4O`@ &`@&@&`"``?@'`@- `@'`@-  2O @`@9  ̴@&`㿠@ @@ ?2@ d ?`@?@?Hr 㿠@@@ ?2@ ` ?`@?@?HU @9Nc>l@<!@ Np0!@ߒ /N+Nt~%NිN> ఒ?姘 2  10?ѿѼh@`'`'d㿠@|@ \`@@ ?㿠@l@ T`@@ ?㿠@\@Y@ ?2@ h ?`@?@?HĐ 㿘@>@7 X@3`@/ǐ @* @@@,@,@@@  i%@%@+ @$@+ ?㿘 '`@ @7N`X@@4b @)@&`@$@" `@'@?@ `@F'`@   2O  @`̘#T @Ȓ@2 @ @,(l; ,`T'(@@%(Ȓ, k?,@e)0@,㿠@ @ /@߫㿠g@  @ \ `@d? @ z`$ @ @ @ o㿠G2@ ( `@@  @cH!< `@ `H 4`@   4b    4 "@d㿠@ @`@޹ 2@"  ; `@&"  㿠@; `$`@ @  @   2O  @/  %` $  㿠@ @cd@p 2@"  ; `Ĵ@&"  㿠@; c`Ħ@ @  @   2O  @/  Ī%` $  㿠@ @b@@' 2@"  ; `ȴ@&"  㿠@; aܸ`Ȧ@ @  @   2O  @/  Ȫ%` $|    @㿠 @@   `@  `@  @ "O   p'H@'H`@`@  H@ @ @ @ H@4H'H@)H @a'9 /  ̬l  @ <H@  @ @` @/ K `@/ H @   : @S@* 耤@CJ .@} `@@6 \@t @ `@)@, \2Hk`@"`@&`` @ @` @    @9 ݽ9 ! &`# @]`?&`4@@)S @(@)˒ @@ \2@(`?&`4@@):@@ؒ /2@`?&`4@@))`&`4@@)@) @`@&`@) `"@@)!`@ `@(@bܦ@)sL @`@`.@ `L /2@ L~2@L`He@] @Z //`(`@ @@@)*J /؀@ ؞K`/@א@d ؄'@ؒ@cϐ@)L؀ @'Oז 2@/`L @ L @L "O @ "@ /`O׺`O׺` L O @('@'@cH&O'㿠@;?blcܸ@5 l@g ` @@) `  @` @@% @#l&` @' !l@' @Hᨚ@@ "HK`K` @K`J` @` K`O  @J`K`@ @ `\@ ` K``O@ 㿠@;?`cܸ@/ H@gJ @'۽ ` @N` :2@$``$`@a$`   l " $`  & $`$`$`$$` $ $$㿘@9?cж#ܺ@/ @l@g ` @@M`` @H`@D`` @#``2@  @ "@g @Xs!434b"(@ @ @WƖ `  @Ā@'J ~@H " - " l" @&" "  " &`" &` @' H@`@ `"H`"HI /@' K?/@ \@ ' L:@`'@'@`'@㿠@;?a|cܦ@/ l@fy ` @  @"``2@  @ "@( @W#44b@T @W<  `  @ĀƐ " 1 " !l " " " `" &`" &` 㿘@;?`Lcܶ@@f/ N2@  @  2@   `@ @  @Āڅ " + " al" " " `& " & " & 㿠6"@`  @  "@@, @ `" 㿘@@'I` @˒@&@&p 㿈@bT@"@`  "@'22@` @@@&_  " &@& H@ @ "H"H%1 K?`/@*%N@@bY `'!O /@ \@N@ @bH 'H`:@ N~@ @b9 `'@b| @2@"&`'`? @$@%&`@&@%֐`@$@%ϐ?@"@%& `@# @%& @&@% @&`$  @v2@` @@@t5 &` l@@%;"@_` `@'7 @% " @&H@`@ "H"H%1J/@*N>@@a  '!O?`/@`\@-N@@a 'K:@ N@@a `'@aȒ @&`@& @H'@%'J @  @ Ȑ@  ' "  @/@%m&@%j@`@ `@%@$& @ ` @&`@$&㿠 z@/  2@  2H @@@ _"O   @ @  '`㿠@;?ctcܶ@@c  ;2@  "@ @@@e&  @u"@   @ &` 㿠@;?bcܸ@@cÒ  %% %``&`㿘@ @>@<@$א@$Ӑ@ @@  ے גϐ"@ "@ @$@$2@  @2 2?` @9?a#ܺ@5 @l@c_ @` @@ @$J ~@ /% /H@ @ @ :@ :/@ /O `@. @ O/NO  H$N@o @' "@ @T94 4"l"@@@S  @wpLL8 @x[ )L@wfLL @@ @@T44"@ @@SԘ @x@L"@m O/ @O/L@]?P@7OL@( HD @^DH'D@'H@#'DHD'H`2O`@%`@#^ @] ?@'@Z @wL Q  "  %" " " " " ` `@` "@&`&`' '  l@&` 㿠  @ @  ?@# @#  `@ @@ `@$`@# &   @  `@% @#   @ @`"@ &  @ &  @;9㿠@ `4@֣ &``@ @'   `' ``@ @@' `!``' `"@' ' "` ' ` "@' ` "@ '   "@' ' `' `' @; &al&` 㿘 @ b`@@  H5N@+  @" # " @"cH @ "H"H,8 M /@1N?8@^ '( H`/@"`\@ `@NJ :"@ N<@^|  ' K?:@ )N?@@^m ' @^3 @"& & b&&`@&@"㿘@;  a al@@  @M@ ?@"} @? 㿠@3 xa`@; @!`b &&` &`&`@B&` ? @"q՛.  @ &mo` `'`$'` #`' "'``O!`@ '` ``$`$Oj "  " a" &`&` &`㿠@   "Ԁ@'ND@)@`"@& @& @" `@B 4.`` @ &mo` `'$'`#'`"' O" @ '` `$$O " ; " a" & & & & & 㿠@9 ` a0!@@@@ @"@``` &`&㿘@``@ @/ 'Np@)t@` @@ @"@```"@@ 㿠@`c @@N?@)A@ ` !@ @ @ @Ē"@`` @, r,, @,$$$@ &$@!2㿠@9 ` b!@@@@ @@&@ &`@.@& & 㿠@7 ` b@း@@@ @c"@``` &㿘@#d#```@; N@(a` @ @;"@``d```@y  !&H @d`$`H,, d`@nd. @? `@$`` @ @` @` @B$`$ $O Id#\Ӭ,   a@.@&d`@d. ? @&  `@` @  @ @`& %`$Ocd#d&H @`` HL, d@ d` @--`@@- `@8`.   @$% nl```@$``!`$` `$&$ O# @4@f'`$```@` `$OX'`#\, @.@d@ `,) @@(``@8`. @$$nj "``"`"` "`%"O%@" ``!`$O'`\'`'`R@ 㿈@/ 'L` @@@L @uǔ @ L @L @ L @2@` &쀤`@  @Ӑ   " @e  &` L@Y@?@u{@P@E@A?@"+  `@@@Ԗ@3S "O&`&`@@`@ &``@&`2O``2@` $` M<@@W?@MI`@  `@$`@< 㿐@ ' @`al@ @  @;  " @[  &`@t@N􀠠@C@?@"+  `@@@F@3Œ "O&`& @0@`@ &``@n&`2O` 2@``$`M<@Wm?@L @  `@$`@ 㿠@`cT@ @! M|4@&@!` @ @ @"@``@ `@ `2@7M``&.@`%` @ @p&d @@W?@Li㿠 `@  " @ @R`@$O ѢѠ& & 㿠@ - `@2`  @ &o`o  ``'?`$`'?` #`'? "'?``O!`@ `' `` $`$O`ΐ "  " a" &`&` &`x@`  #`@h @ N%` @` @@ (OL М-@_ M!|@#\@@i=@6@H$@@%3y @@. @j'`@ @m&"""" "$`"4O#\ @?  " @ @u`@$O Ő8 " " " `@ `  "@&`&`7 &` ်@&` H @a`@@ `@&   & >.` &  ;M |@@j   & `@ @$`@$O  &     @``@k,`$O"@ L 2@$ ,  ,  $& "   "   " " " " " " " 㿠``@! `@`, `@`@G  `@`4O````@㿀@ c``̠@@ $`@ @@_` ` . @G @ @@. 2O   @- 2H? F)  `@ `N`J @ @@˔@ 2O   @, 2HC U/ "@ XϬ X%UU? ~I0 <? $  @*  H\- @$  @M 2O ) !` @ @` %`%%%% @Q%V  `@ `N`J @@o@  2O / `2@@  % % %%% @#%/"@@@Ɂ2@@  %%`%%%% H %%@  b`%% Ό %@*%@qW@֐ @@p@䀐@ %"0% j " " " $$@@@@k㿘 @@I  / `"@  `@``2O` 㿘.`X`$'@.@` `" `@'`@ڐ@   ,``@@@ ``O@`"`'` ' 㿠 \``@ @3`\ . `X%$`\-@$``&`?$$2H&㿘` $ߐ`.%`%`'```&```@@㿠 \ $.'@ Xȑ.`.`@J@!+*` @&$ b : ;J 2 :`: !( (`@$ $O @   @@ &b:`=K2 @::`!@(!(@&@ &O  d@.& X & `& d㿘@cP ̶@@@c` ` . @O  @@  2O E` @@"  2@ ` %$ `?'``@&`` `@`@` @ "@ Ͳ  `&`!`%` @ `0 @L`"H%``@&`@? @3 ` `@## J* J@ j* @ J@ )` J*`J )`JO@* @ @  J*   $OJ 㿘  /`& ɑ/` & `@`@n&&`&O&`@&`6O& ` *`*& `@&  @@Q $` -` $$ `2O`4O` @ (@c|`@@ '#M|ؒ  .@ @(@l@(@l>T@l<@l9 &@L@J @L @ @@ @  `@s  a @ P @@lؒ @@HO >/4  @lĒ @k?@l @k?@_(@_@(@@l @@L@@l @y@L2@#\O̐ "HLM|e @ "@   2O @ '40@H&   @@k?Y@@S M@8J `l@ Mi@ `Mb@`M`@'1  @]@  `@ _@M O@ %@kd ?@% @ % @14@#L@Gǖ  @^(@l ((T@kD?MT @k> (@k:?M@k4 #\#`Tې@z @T;4ct @G `"@m ƀh ! + @ &a@, &@(&`!`&& &&@"@ `@4@c?Д?@GX 2 @)M= s ߐ "  " M>l=.@HԖ@G/  74Ķ @E @k@kT@k@k㿠@9 `@!@@ @ @  2@   @'@   2O ʎ ʋ $ * @ ʅ $ @W %$ $ $ $ @%M$@ @ @2Og -5M" l," @@㿠@b@!@# a `"@@ 74ܸ?@F `@F`@F?@F ``O ϐ@-4 )M=4 @`@F @F@F@Fx ``2O` 㿠@ `ʅ 2O`㿠@; aLa@`@&`jhf`2O㿠@; `иa@``@ `@'`@ @%` &  @a L `㿠@O?ρ㿠@ @-@ 'c̶@W`9Ӹ@ @ `J -@Ӱ?`@(` U? M( U? M=<(?@r8@j0(@א M}D"   @rV`@'`@x  @`? ?T UwT @OX @j?2O `/ML %` @r(`@%`@J@_ b'P@ P@;4cM4M}T @qݖ@7~ƀ@2 @Md_?@DaM=T@  <) )@)5 $ @ -)  "@1 /M  M @pW M="` @@%M P " @묖 ؐ  Ԑ @) ;@` @P @@.@@``@ @'`@@Ő " @ 'L H) ``@ @'`@@  " M@P@#2@''@C}z w `?@'`@h@  @" @@CĐM}uP@q@C " @ŒLL`@ `@  M}Ēs@V%@0S@DP @@O " )MP=" " " " M=Ȓ@F M=ؐ@  ˞`@-M&`'P@.P@Җ  ' @ ˾A`&`  @) M"O`) !`@`@$``@`@'`@Ð5@,;M~@,ѐ(@, @6Fb @a#@ "`㿘 @` b`@@ @%`@@  " }@'@@;aΐ | 6`@ `@%`@\@w " -M@O @"N@ & c &  Ֆ@? &``@%`@.@&  @"  ʸ`"@$ @3@BXM> K '@0@BH  ``$`@~@ @ a/M, ` @$`@@  @ @ &㿠` @H@#4` c@ 2@`  @n 5@2@@"7M B @ @A5MDߔ  `@@+M~Ӕ  "@&`&` d`@`  㿠2@TX`"@ X@'MbLH@@ߐX&X&`&`&`&`  `&` d&` d @   &`&`&`&`&` &`$&`(& `& d 㿠 `& `& d `"@$@~Ɔ & $@@e X T" X @`2@&@&@ a@ @ d`@!M>x' '7N` @ )5 @A< @PX #\#` @A*M`2@`@`@@A55\`x @P1 DŘ @œ &`@e&``&`&` &`3 &`P ``&`T! &`X`&`\&`L"`% `" &`&`&`&`&`&`&`&` @  D@" @eJ@eH`@#9M?>| @ @eE@eAD@e=@e @e6@e O瀥D@9 &`@ @f @f 㿠 P X`$@ T T & T @   @ "@#& #& `@`& T@@!`@@}Eu s ` \2@ T@ & T㿐@ PaT@@L3M P~ @+M@l ~ P @@lږ @ @% `$ @}  u M P ~@@m͘ @%@ @ $ @| [ @M P @ @m  @ $ @Ӑ `@|ې D  `R@  $I2O .  @ @ "@& &  0@  >'2O  Ѐ "@  Ԁ@   ` Ԯ Ѐ&O& & &  `"@& @ & & & L㿠  Ɓ㿈@bh@`@@`Ѐ @`Ԁ`@   Ĩ`Ԯ`Ѐ&OĠ&`І&`&`؄#\#`@"@@G@@B`Ѐ@(`Ԁ H   @"@> `Ԡ ``Ѐ &O@ `؀@,+ ߑ,`Ъ@bb`&`&`Ԑ &`Т &`&`@R̐ @``й/`&`Ԯ &`ԁ @?235 5``  @NH 㿠2@`[ Բ`@ `к ?@I@``Ԭ&O`ж 㾠@c@5`@M @ @. @-/M@@IW?' " @IP?' `"  `?@'`@ @! @@ @@V@̐@ 5M@>Ȓ@@JU? #\#`@"@;5@>15` Ж@@@M  @'5(@@ @>Ԗ@M  @>``#\`<`@M `ฐ@``-@` @?@  @a@ Ԁ`@  Ю  @a@  Ԁ&O y`@H  $@    @ @>17535aԴἒ@@@MH  @b`@b? @@ M>@ @b @b? @'$@@#$@ `@ @$@"O;5@=a#`@  #\?Ȗ?@M@cO  t   ̘@6' ' " @c;b " 0" %0%2Ob `@b@@#\#`@Ɩ"`2@@=5 5b @L˜  @@&``"@O 9?` $@` @?"@```@`=@А2O`  @* @.@䀥@@  `@@  @`@p2O   $@`?@@ 2@   $ @   $@ "O    `@`㿠 @0` @@   @@   2O  ;M2@  %0%   ;M~@4㾠@#\\ch` @@N`:@2N`:"HN`"`8 @ d`2H`N`:@"N`:@N``:@ ``O``:@O```:"O``2@"`\' &"`$ "`  @"`! H, ,@a,O`@  O``@"`:2@M`:2HM```:@ ``M``:@M```:"O``"@ %@M```O〣`:%@@M:@M :@ @a @`ڔ,@G@#@@@ `@   @ M0 @z` `@``@ 2H @@ M` O \' '`$@ax ' \' $@ap @ @(@$M :"H $$ ' $N``@2H ' \'`@aV 㿈@ch/@#\#` @@ 75@=h@;ΐ-50@@@J 㿀@b@@' 䀦@'' `@ @(`@ @ @ @  @ @  2@A   2O #\#`  `@ `"@ ``ŀ``쐐2H ``@"O@@ 95@<@;L15"4"H@@@Jd 㿀@`@@' 耦@'g' `@ @(`@ @ @ @  @ @  2@A   2O #\#`  `@ `"@ ``ğŀ`쐐2H ``@"O@@ 95@4@ @F ` n@ L8@@9 ` t@ /L<@@, |` f@ 9L>D @@ o` o@`@L~L@@ _`5LP@@e T`@= 쀦@#2`*0 @+N`    @@ 'N O 쀦@z+`@쀦@3 @N  ` @& @ 'N O @)?` B``@``"@&`@&`1 "&`  @;L~T@@.@,@9? 㿠   0`@  1* * & & 㿠@; 'Dc@a'H@` @5 h` ' $`& `& & & & DH& > ֞㿠@'H'Lb  `@@-L|@@"@HH9 > "& 㿠@7 ` a@@@`> @ @`> @` at@@" @@& @;` ` @A@@)L  `  @@ 'L O H "@+ L@I@-Ɛ@,,@9!? @   "@>`;``>`; b&`  @#h#lhsl 㿀  @R @ & @^& 㿠@; ca@@ @/ | 9 @"0$& `@& & & & & & 㿠@  b`@@-L@@"@& & 9 "0& 㿠@7 ` bl0@@@# bD@"@^`@_@+ + bD` 2@`^`?>`?<23* o` "@ ;L@5?@+8 & 㿠@a`@@(@5 0` @@ "@ ;5cx@,@+N@8C?(0@-n   0@`  5 p@" M` ` @`-`L` ` @ L`` `@2O``-@ L`` `+@ L`` ` @(@[ @" @R "@k@ @M @ @ 'M ` `O  H "@b 3L< @@,j@*А@7Ŕ?@SB @ @`"@/ ` "@+  '&` #H``@ ``@@@6 v`6v`% D&`  @``"@&`@&`+ b0&`  @75㴸@,@*@7y? ( 0@,  㿈 @Q & @ϒ& 㿠@; aPa@@ @/  9 @"0$& `@& & & & & & ٞ㿠@  ``@@-L`@o@"@& & 9 "0& |㿠@7 ` `0@@@# bD@@ʒ@+ + bD` 2H`<?^`23* /` & "@ 5L@+}@)@6ה? & @` c@ @!" @ @92`*0 s`@ `"@E[`@@'L  ` `@!@ 'L O @ @   "@v`sh[hv`; bD&`  "@' 7L@@+@)|@6q?@Q  @5@+@)k@6`?(0@+  㿀@;L^ a ض@@g2 @\ Ԑ& @W& 㿘.0 6`; @a@ @5 s`[` ) @"D$& @& & & v & & 2`*0  2p Ӟ㿘6 .p  @@`@/L@@@s`[` @  `"@v s`@[`v 9 "D@& J㿠@7 ` cLD@@ - 0H `&` ?`v`^`v @^`v `"  @" r  ;`" 2p? @bX"L? ؞㿠" " ``&`㿠`2@  @  ` @``@ J N@ "@  NJ  O 㿠   @" k㿠``@`p`@2  @#&O` . O``@oa.  O`@`+`O *` O (OO. @ O`.  `@$OO`㿠@ dc@,J :@ J :"H& d p`  @ "p@@ & d d``"@ ``@ `@@  L` @  ` @  `` 2H @/ p`"@`& d 2H& d㿠@7 ` bpp@@@" d "@    &# " `" L" "  " @" ``"@&`@&`&` &`㿠  @  @&   @"`!d"`@ ` bp "` 㿠@`a`@@m 뇖 @  d"@ ` '`Ð " "  L"  " ` " " ` @ "@&`&`; &`bp&`   @b  "`㿐@`7 `cЮ`@` ````@   #d #\#`@%>Њ` "H#\ `  #d#\ #`ƀ;#h`#`#d` @1K< @@s@㿠'H'L'P'T'XH㿘@bt@#\@@ "@ڰ \;6`,@&  @?@?' @ 8'   ' ' ' ' ' ' ' ' $' (' ,' 0' 4@  "@@ @' 4 '  @@&'     @@,`@x ,` & @@@O@@&  `' ' L `"@@@a ( @ `{@@@R (   @@F ( 0  @% $!   `@!  `"H! @K@& 2@O' 06 @"HL?' 0 / "@ "@' \6H@%g '  ' 0@ 6\ l@@%\  ' ' 0@ 2@ ('  (# '  ' 0  ' 0 $ '  t@~" ``@HH@@ @HH@2O@`\@ @ H` @?O倢` "4*  @! @-H`  ` ` @`@"+ `a@ 0`(p0300@ )`3``A@ ə(p0300@ +`2 Ѐ+002p0@ )`22OH2 㿐@"@ & @`@@`@ծ N r@b@ @p H` a"@! nb@ fH# n"H$ dv@ r@!tH$ u"H8`Xv@ x"H#Q 7 7  7 7 7  7 7 c @ x77@ P @s u7q@M G "O 7c \7 ^` @` @: 8@8О``@7 MM @ E8@ @Ѐ`, @7 5M `@ ,8@ '?О . @ 7@;@@: @.@@:  \7 2H&@:8㿘@M'@@C@L` @`'@@2OL`$@ #@."H&L`\@k@'&@@`Ж &@@ `$``L` @`2OL``$@&O$@ @#\)t@>N cȦ@L@ #`   @ 2@@*`@ $`@&$` ?@ N H@@  ?@N H"O `$`& $` &N ` $`&$``&\N $@,@2@ .` `' 2HN \[@I, ?@5(@@#@( @I` ]@H `$` & $` &2HdN g\ O, @ 16  @" &  `&4&0 & &0&4 \@1` `2@ N $`?  `&2H4N 7\` @ "H&4``"H $`\"H9 =&0$` &`' 2HN \HK$`? $` `&2H N  \|[N J"O$\@@@ 2@@*` $`$` $`$`&&0 㿠  8@& 㿠  8t/` /`/ @  "@& & & 㿘@@@b@@@Ր @ 8& @&&&& &$&(&,&4 @$@Ð/  @  @&`    N``{@0$ $@$ L }@ ?@L`}O?$ $$$`&/  @ +6`@@! &  #&0}&4$  $ @ $ @8@@8z @g- @8o@-_@+:@@M :@@"M :@@M`:"OM(2@@$ `&%O@8$ `@&& @0@"@ ,H`)@`/ , @ 6`В@@!n &0  & &4 / %"$@?"  /   %&&   (@b@? @-@`@&@5K<@/@ @! @ &@#9`@ 㿘@Բ"@Ӱ @a@@@ @ 8& @&&&& &$&(&,@`-  " $@t$ 9t >L   K`@ {2OLb @ }H  \"HU`Q2HN@$H`$$` &"@y '` ז  @0%@L @+`"H&4 $"@`&` &@$*` `    & #  %@ 2OL &   &0@.&46ܒ@ \ @% -L  {"@  "H #"H` $"@ $L ` 2@%6$8OL@! Ő  㿠@@"@? @bh@@@ @ `&8 &@&&& &$&(&, @0M`"H` @ 16,!@ &  &0&4"@  `'` |  &  @@ d&  "O 30?V`㿠@V؁㿘 "@+K`t@>@J `@`H( (@:I )H ` @@"@`K``:"@ `@(OK` @\ c%`N`@C@ @@A N`@` @B %` "@m `@@z @6aHd $ @z 2Hd6P6 6a$!0 @   & @ @ %`,96! @  ,t@ @yՒ@D, @`)6!d@#\#` @ w` %㿠@@/ a @∦? ```@$" " O㿘@; a b@` @'   @@}@@?2@  @ 2@  2@% %`F A   2O h@`,@@  @ @} ?@ ? @@F   `@$O2HĐ )6K!?@  #@| ?2@>@5   @@Ȗ Q:`@`@K@EՒ  @9  ` @E̐̔̒ $@  9@1@@ @>  0@ К  < L@ @9 @ `; @&  P@   \ p@~  t@x `@$O2@ ?@H @C   ; ?0 @` @&`@6H@G  @  @ K`@&` @@ 56l @*  3P@#p#t \\#| #l#xwww@wt p@p! l`@l" @B{ '  ' `#h#@  ' ?-L>@2@ǀ<"H >@\|H  #@'@x`2H'M`<@& ''M`@ @  @  'x-6   @ @  #\#`#d   @ ' `@ˤ I  L>@# &M ! &@  䀤@ '@xh"@'쀦@  '䀡`@'  @xT耢`@ '耦@ '@  #\#d#` A@'@f䀡 "@'@x+ 2H'`2@h  &L`>@ ڬM>@  @!'@x@$'!䀢`"@'@w`2H'L `@@# L  1@# L @## @  #\#`#d ښ@ `2@  @f  ' @X*% @`* ) @ !@@@ ,% %  @%  ml ` @$?$?$?O$?@@  `'```$O`&@E `@% i`o````'''O'@ `'```$O`&@ !x+6b  @ @T YL`&"HM`@`@E@@  # `&OR'@  x6c  @ 6`@A"@t@v@''6,x  @  ') @t@v@ qx%6X @  'Ȑ @ @v+ @' ' @(p@p@vȐ@ Gx56@ @Ԗ  ' @ @v @' '耦@*2@l%@@v @ x)6# @ l ! r @@uՒ @ 'L*,``@ - @@p@@)I`|2@ I` @ &2@I``@ @`@&O@@'-`'@vD@F@@' -` @v4@6 %@#\%@vM@D%@@  %  h@#h @@v& @'@@v'`O-|x#6cܒ@  |b#  36  36xb@ @ @u`@@ @u @"@t@ut@ t "@p@ut$`p@ p "@l@up% l`@ l @`@ul%`@h @h` ?@ F$Oʐ?#h@@ "@@u쀢`"@@u䀦`"@h@uh㿐@~'bw@ @ @@#\W@A@)`@ H%7@ +7`T@@` (= @'`@2@ %7@@J @vH!/7t@@9 @ʐR "@@u)`"@@u# @ @u @㿘@~`8@@ǒ @ @~! '`@~m'` @7 @"@ '` 77#\#` `Ж@  @㾸@}; c@b@`@5 97!   ??!`@ @t `@d`+7 b\`2@E#7`@Ԁ@ "@ @ܔ $HO􀤠3@"@ @ɔ $@ @’@ 2HO뀤"@ @ $@ @ 2HO퀤@ @Y $`@ r@ pȔ?@ @`HG`` @@77#\#d` #`@7N@n @%@#`@f@H@@Ð 7a`#```#h#d#\#l@&@ p``"H7@%7<  @'#`#\#d@ @' 鳐@ L3K|t<` @ $`$` @Z7 `"@0 @=L((@=S?(@=ΒK(< @=J @(@=C?@(K@=; (,"@>(@@#@G @Z `"O`H쮐@7 7"`@ @%OK |ِt @v "@K ` @m ap#` #d ?#\?@_"@4   @V @ @'`' `@ @@ 2H #\ "@``' `97#`"` Ԗ@* @㿐@|  ``@@"@397 `@-@ @=' @<`@@ 2H #\ "@(' 57#` Ԗ@97#@ #\@ט `` @Ϙ 4p8t, X㿀@{bب@@ /K ${  K⌊=< z" "@ @? H@I-@G  ``@"@`w!  "@@&@ $@ !2O`$O` &@ 5K D{5  @U@ u@``2@   脒 2H  @ w @ @_ @   2O @ @ @   @    `& @{m2@& %& %?`& @{Y @ zĖ  `w2@ 2@`( H `(`@"@   @ѐw$2O w @5KJ -@ K=|@zؐ@@%K@2@[  v ! H  @@ H  K}` zc V @ @ ?@@( &@ K} zF @``€"@  `"@  @Ԕ  z @O@ $@5#KgJ -@K=@zW@@%#KW@,2@ڰ N = ! H B @@ H  #K} y  @ @ q?@ @ ``@@j  @K` "@$J `@&` e&`@z7  y @ K=Ȑ y  @2@b @2@\ @@ؔ אP @ K}ܐ yo `€`@<  ` @6 @  2O . @ 'K yM  @i2@ @c2@ @@^ 7K 㿘  @ @ Ӑ " " " &  㿐 u@"   "@B@%@̒@ɒ42O.ul2O u @!㿠@x7N`c̴ @@ ` @,`N` @< ` @ .@`.@97* L=  O `.@97 97#T@@ɘ  J  J``@`.@  (@ J + `@@ `.O(@.2H * @4.@)  *@ Л+ ` J`@ .O* 2@` H`@ $@ "1 2p?`" $@? ?`@`J  J` ``@  J `@  "   |x<( p ` T 4 l  0<X,   H @d t  Pd X @   h D4Hp\   \ , x  ($L8T| h0DPl 㿠@wc@@x( ' `@A1J@?`.`@@/K,3K~49K><K>H K~X;K~`Kp K>xK~!K> %K)K>-K1K>7KKK>İ K̰ K~԰Kܰ K~K #K'K+K/K$3K49K?<K?D KL;KTK\ K?hKx!K? %K)K?-K1K?7KKK? Kİ K̰K԰ KܰK #K'K+J|/J3J|9J<J<  J|,;J|8JH JJ> J~;J~J  J>,J~<!J>D %JL)J>T-J\1J>d   |x<( p ` T 4 l  0<X,   H @d t  Pd X @   h D4Hp\   \ , x  ($L8T| h0DPl 㿠& @t c\@@?l@:/ @@J>t7JJ> J ;J~ذJ J?J<!J?\ %Jt)J?-J3J1J?аJJ 9I< I|I$ I|@I\ #I|'I+I|/ḬI<7II=$ I8 ;I}LIp I=I}!I= %I)I=԰-I3I~1I> I(I~L 9I>\I~xI I~I #I~'I+IP/IpI?7II?İ I԰ ;II H<H| !HXH~l!H> %H)H>İ-H3H~1H? H0H< 9H?\HhHx HH #H̰'H+G|/GG<<7GXG @G~(@G0@ G~8@ G@@ G>H@G~T@G`@ G~h@ Gp@hxHHX(8(X8hx" @q $p@?8@+ @@G@ G~@ G@ G>@G~@Ǵ@ G~܁@ G@ G?@G@G @ G@@ GL@ G?\@G|@G@ G@ G@ G?ā@Ǵ@G@ F|@ F@ F<(@F|<@FT@ F|l@ F@ F<@F|@F@ F|؁@ F@㿠@q; `b@@@ 1@ +@@` @&&$㿠@p;@c` @5 ` `@` @  ` &O`? @ ` !`?@ @ @  W  '?'`*`O+ ?`@pѕ- `?'` ,'?*`%@`'  %`%`%`  @p⼘"P  `@7 @`   @  &O)F?@""  "  `@+`*   " " " @ `@ }@ F塞㿠@p; ab@@/@  ` @@ &O ` @ )F=4y$ $ `@B@㿠 " "  " `@2 `"  @ "  @ 㾰@oc@ @5F` oÔ  @#\#`   @`2@`@ ΐ737㴺c @  "@O`:2@@ 77 7̆#@ј   @@ @0`@@ #F@0?}p @0 ;k@0 ? li>H+ btdi|}tА@0ِ&   "@P ܏J ` @  O ` @O  ` "O `a2@= F}t@o 2@4 O @   2@- JO g J @3 `   "@ O``O 7hت$` @ *7/7#d  @@ 㾨@o #` '  @) `&``&`D@)ʐ@]`@ @ `;-F|@o@ 8` @ F` @@N '  a " " " " " " "  @)@.  &`&` @|  !@@)z@ @@|`J @@n@ |@n`|J`2@ G(@$`I`@I`` 2O`I )H1 @ {|88;8#\ਸ਼`` @|Ȁ:2@ I :H @ `|#8'8+8#\`ĨК`  @re|I O(@Y@B@n]@=@9 a@4 @ "@.a@&e@ |@n{@M@ |%8)8#\-8`! 8@'|e`F;8}a@n@ @ |R`z`` @&`&`&`!`&`&&&& &`@ | @I& " |&|`@n-|` @&O)`|@ 18%8 Xd@՘ |@ -`8+8`T `,@Ę "H `&`'`'`  @' O``@`&`` @ ?@" ?``2O``@ 㿘@m dad`@@ N``N`#@`e2@@?@3 -    `@e̒2@+? '@'' @ & d@!8@@2O!8&!8!| ?@  `@lc@@ @"?@ 'H  #F} @ l- `d@ &`d`|ސ @*|Ր@ 7F@@l`Đ?&`d㿠@lb@  @ l@9l>H`@"@`  㿠@lb@Q@;l~H "H P@la`@@(`@ ?@ڒ%` @" $O.'@L@T  @@N @Ij@ @)  3 - b@@@$ @ "@ @ "@`6`$$`$O@('-F@k 8c`@?L#\` @"@@Pt-А3 "@'؁А''''g `@W'F   a@Db@;@@Ma@@kՒH-`& `" &{&`l$@  &&``#`  "@%+8& & `$` @$O 3F~ƒ !F>H ࿒ $@I&`l+8a @ @pF~@b?LH@&L@ HL@'*@Ni`@G`@   `@  @a  @[  $O @R   " ` *? `@@ @L@(ŖP@"㿠@#\@j- c@@2@T\2@ 2@@"H$ @ $$ @@ 98 !@@Ô  "@ &  @@\%  "@ƶ `"@¶   % "@  @%%2O   @\`$@Y&  ` " " `" f$  `" `$$$@*$ ` 2@$$" $ $" " "  " `@" ``#`"  @j&Oq耢"H'"H'@'q`?&`% & Ċ 2H& 3b@ į@&  @/+8a@@j/ 2@O@ 2O@ @@ `H`@ H `O `  F8~#\@@j8I? @ @@icL@@@v#8aĮ@ @<@l@$@ΐ@Ô?<@N@ <LN@ @P$L@ L$ ` O$9F ?$@ @i? @" @㿠 @ @" L @! @  `@@ @ @" /2O}㿠 l @C&lt`@ @i8a(b@@Ò?  `"  @3 `@'`p& @@?  `"  @2  @&`&l@i~H  k@h|# 㿠@ @h;FcH@@@_ @ 5 '`@'`   '   @hb"`#  "`     @" -㿠@h;FbL@ F@hh"d 㿠@h`/b$ ᨤ@L @6`P` )   & )`@% B@LP 2@ k $ *`@ @ @@&"H & ``@Oӆ98& "  h @'LP (@ ? `$  *` `$ )`Ѐ @D @  @' &@ &@& 5 LP@@7   7 $ *7   $ )  `$ (` $ . `$ +`耧`@ @ @@% &@@ $&  㿠@h @㾰6&` 6&`$# 2?@(V,,@6?0?7`@4@)8,㿠 @@.`&& (`6@ $&& @  ( @& (`@&㿠@g`bL@@8H#\``,`(@}@`@  "@ ?9F?@?  b@ 2@  ," 0" @@?""*` (@" (  "㿠h@?h㿘&` &`$@@-%@'㿠@ @?   ܁ "` ("` ,"`㿘@g; ` `<bԸ@@`@M@ϖ2@4   @&4 "@&`ƀ&`&` 㿈@f;Fct@5 @}`@f@ݐ`@ ! ` "@ O @% ` 8b@  ``@) "`` "@```@` 2O` H8" @  @f;8bb@@' @3 d d@3F@r 8@f8 f @ d8@   4@" 4@  @f4Ԙ!`"4 "`"` 㿠% 2 30?`@f/@ $@D!l @ e $<!  @` |2@``2@ ``@f0@ ```@L`` 2O`xF"@-`  @7%- @'nn`D`&``a&`&`&a` `n`n`&`&`&a```&` n`Pn`&`&```|`&`&`O&`@ ``x`&`&`|&`&`6O`$$$|M 8?" " $" ," 0@&+,,@ 0 ' 7`@i%@', "@  "@Q %F #( ' (' 4x @  h 4@" 4@9x tt$d""|"nnD?& &&& nn&&&& nPn&&|&&O&$@e$|$㿠@  ( @^\㿠@e;@``$@@L!l @` ` 4@" 4> ``@%    2O &`㿠!!ш&`&!  "  &` @@`&`@el &` &  x@2@ &`&`  |&` &`&`& x& |& & &` & & .!㿠@``& `@!& @eG`!` 2@&  x "@& x` & x`& |`& & !@%ъ!`&!㿠 `@&&@d` b@ @"@` ` @ # b @- - "`$ 2@ @ @㿠  @& !& .! 2@& @d $@! &  & & & @d͒ &  @ @w@@㿠 N @@S @@M @Hi `㿠!&!``&` @"' @d `@@"@   @ # b @+ /+ a' $ @ @! &  & .!!& 㿠 O` "@0!@cc@@!@d @ / `$`$`  r$` @c`.@$` @ @ & ƀ & .!!& !` O` @Ð `@ + ` @u  ` @ @@b @@[`,`@Z`@1#@: " &@+ ``  @# ``j`j ``"  "?"?O"?  @2"?`" `  $O`( '@`@'`mk` `###O#@#` `&O@cS&`@O@  x@  O@@ |H`@m`@   x`@c}@c* @& $O`@$㿠'H'L'P'T'X:H㿘 O` @ @ b @4   x @ @ J @  |@H @ x  @%@  & /``@ & 㿠  x"@  |!@& x& | @b&  @LH@@b& @ |@d  x@@@b |@d@- @b  x "@& x& x& |@ x& 㿠 `@ `@ & @ & @㿠@ @ @t & ƀ & !!& .!?&!㿠@b!9 `"@@@1 % @ 4@` @  "@ @ "@`;`%&``@ γ`&`& &&&& &! @ "@   %% @ `"@% @% 㿠`"@!@a;Fc@`  @+T ` O! &!㿠'H'L'P'T'XڒH㿠@a;Fbܸ@ @+S !&!㿠@@`@4@a!bx@@!E< w! '!%E5 @*# @ 3E/E @+# a`'a| @* @ l'`ly9 㿘 @a @^@ & @@]@ @ @w]2H-& -@@i]O-&̑,@& Ǒ.& & & & & @R@`]@ `-2HL`'`( 3@?`]@NL`-@`-@@6`]@``'` -`4` '`+  2@ -@@@  ) 0  (`@7  &   ,3  *@ 1` `&  `'`. 5@`]2OL*`2 @   @ @`@ &O @   @ 4@  @@   $O    `2@     @    㿠   @XDDH@ `#\#`a`'H@@    .@ #@` @#`o!'  '?'?O'? @  '   $O'  HN @ 9H  @ @HH@'H %@H@?H'H %@v *@  H@3H@'H5 HL`HB`H"@`\ J $@ 'H@H@W'H&@K @ @  @?  `@B   @`@HH #@`* H@H@'H L@)   L@$  L@ l@ h"@H H$@ђH 'H@@H)9` `@@\  B\`$ ;@?# [`@@m*@  H $\!8#<@ #$2@Im$@CHI`@6H@H@'H ^@ HK`@)H@H'H ]2HHHH @H@sH@'H ]@BHH @ H@eH'H`]2OH2\)8#@ ڦ@ \-8*;8p(c@@@ B Ǧ!8@ \%8*#@@@ / @h@a@@@@9--":! @@  ` `     `   ` ? ? ?O   ``    O @/ !@` @!`i!!   !? !?O!?4@ - !   $O! - @ !@HH`2OwH \%8 @ ;@2H` @`"`@4@ ``@`@&O&\-9(@  `@`&O`;8\c@ Ք @"@  k @@ c @pX P P P $ ` ` ` ` ` ` ` | | P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P h h  \ \ \ \ \ \ \ \ \ \  @ ]#\?#hb4@#d@''E \( dh@]]h  \'#` @ @ Ih},`@A@/.< %@ ?`#@<!@20? !`0p?"@   @)?  `@! ka#``##O#@#``$O#`h #``@@ `#```@&O#`h c N @   d5# #|# @`(@?@  @  #x#l#p#t@@'@@@@@L`@ @@@w2OL`  `%@ @'`%H`*L`"@ @@2@ @@  @ג@'%`@ 7 t  @ / "@\ H $@  '@'`@t @@&`@\ޔ @@'`L `L@`l@`h"@ $@'@?!`[`p @@D+  2@2``$@_/` ` " %&l i p#|#*L`l i p#|#"L`#| i #L`#| i #L`#| i # L` f L` s L` c L` [ L`@ @@3@@ @L`O  L` H i  i@ [@7 cHk f"HU`̪` i@s s@ƀ`"Hx'L`@@@w@ `@'J `O 2@"@A /```" `܀`@x'M'J `@@ @ `@'J `O @"@ 2@u"@  /```" !h`@  @b@˓/``  " X``@؀b(H p" p`@['L`@?%+ Mx@P*@  @    @"H @"@,?O?** 2@&?O ?O#* @  ?O* @.?O* @(?O* @"? * @ـ@ ?*  '`L`@ `O "HJ?  2@z J? 2@oL`J?`x@`XH " '$` @『$* @+| ŀ2` *0 @@d E? /`` " "`x@ X  /``" #@`ʾ  /```$&` "@    @bH;";ؖc0`@='L`@?a(@ᰆ! +:@2( * @) * @# * b@ * 0 '`L` @ `O @-H"  F @%2@! "  @2@L`" J e@$`'E2@" ''$` "@$  "   2@`* @Z #/``#M " %`H``2O(    ``@8 @W39d`ؠ h @ \`  @#  @" Ƽ 2@`\ `@  ` &O&R`@ @  ͒ @ # Ǝ ;  &O@zѐ@%`@`@` @ɼ?\@  \ \` @ɧ\Y㿠@Ya@@@ @Y) !@ `@7  `@ $ & `& & @& `& & y`& @Yt /@& Ǟ㿠@Y9 `!@@ @ @  @   @`  ``O .`@+  b# @' &&&& ƀc` @ & 2H y>`"  " 2?" " .` @Y@6 &㿠 @`?@+@ @ $ @ `&O$ $`&@ @ y`$`$ $`@$` @`㿠 @h 2@   @.` N.`6 㿠 @N @ H@Ґ 㿠 @< @ H`@ `@&`㿠 @% ?2@    @ @@ř&  @  &`.`&㿠@X  a0@@+E|X͔@"@& ŀ& ť@`@ @XN@ 5  & & x& @X? /@& 㿠@X `@`@@E|Y  @  @$@)   @  @/.` @x̒`& x` `@  @@XK& ' '  `@+ b& @@?,@' ' .` @  2Hx& " >`' .`30?' 6`' & 㿠@W b`@@7E @F `@$@/   @ ` @4.`b@ x`@ xN`2@  `@  @@Wܐ& '`'`   @ ) "& @?,'`'` .``@  2Hxg2@&  '`>`'` .`2?'` @6`'`&  㿠@W`@@`@ ``@ `@`O @. @/ / ` & 2Hw>"  " 2?" " . @W"@6& j㿠 @ @V/Ec̬@?@ @`@`@ @W`@   @@@㿠 `@ /E@Vc,@@@  @l  @@[@㿘@V b@@T  @  `` @ @` @ `2H @͐`  @/ې@Ґ@/ ` `@@``@ @ @ @ &@㿠@`@@`@< ``@ O@- @ ``@/  @./ '`  2H wL@ '` 2H`w &  ,``/ @VD@5'`Ìȴ@`@!`@ ` `@  `O @@},,@0@,@d,Ⱥ@`@ @V`@@_,@,@;s@B,㿠@`@ @U@   @ , @?% %  @@Uɔ /& `  @ @UEbd}D@   @:` @u  ` @ @b@@[ v @Z @1#: !&@+  ?  @"   i i`   !``?!?!?O!` @2! !`  ` $O ( '@' k`k `` #?#?#?O#?@`# ` &O`v@U?& @``O`@< `@ @  -\@$-`@  @? `@L`"@`-`L``@ `-```L`2O-`` $O``2H-`& @u㿠'H'L'P'T'X*H㿠   ?@:  @b: ' *   2?' @ `@ .2Hu"  @@@ O`` @ 6@@ɒ@@*OO`6& 㿠 @T b `@@u "    2Hu "   ,@T  , 3  & 7  `@&  & `& &`&` 㿠@T9 ` aL@#`@# @`2@  `   "@'` '` tѐ " ?" " ``"@'``" ``-'` 㿘@T  `x`@@@1@ 3 b@ & &  ` @@ &O t`& & $ @ ` @ђ`&O`. u㿠 @ ts @T& @}  " 㿠``@"&`tT,`` @   @%```` &O "@&`t&`&``.'`&``@ ` @ `@&O )`"  @Sc!̔  @Sc! ̞ @Sct!D  @Sc! x @Sc  㿠@S`|@@T; ct`@  @ @t0& &O@S㿠@R; cct@ @t&`&& @R`#@ ?(`bπ@9 9"   "  㿘@R';b`4@ِ@% E }x@@!54 8 < @ $ `"@ `  `  `!  !  㿠@R;@a`(@@| 3Q-Q}`,)R>;  < 㿠@R;@a`(@7Qr@/Q`,@@9 @  @  sL& 2O 㿘r @M> ӔJ 2 Я? "@> %, % $,*`&(!@) (` @ @ %  '?/@% `% % % ` '``% `@  @@@2@  @`2O`@% '` &` @&? 㿠b @ @ @@ 2O@" rՁ&rс㿘A` @ `2@#w`@" "@ w@@L &@' @;иb@?'@ &@w'㿘@QaФ@ `@- @)@Lf``$'``@/Ь@'@ w`@'` @  &`9Qq ? " | 㿘`@ "  @L3 @  @@ @@  @ &  r> 2O  i  㿘q " " " "  2@' & &wi㿠 @1  2@& @!"@  r `@ $ `@`"O q@& @@"O  2O &㿘W @ ` @'` @  '` "H'` @ qɐ` @ 6O @w h@Pb4@"@ -E Pd %ES @+ q  " N#E" }~ S[b0  @ '.J +@-@ / @@E`D}Д̐ NØ @ %90:  ̀ @ Hp "@7E@ E=ܐ P @g HȐ@= @V @( N@@@P%@  2O @2H @@& @?@& "@ذ  @3N}̒@E @ )E= O pO @" % @ %  " 5N%`%-E% %$@O쑔  @E~ "@ @ @O쇐  2O @ #E~  OM +9@qad@ Z  aS @ǒ?H Č "@  @'@@:' o @" '` @ '` `" N=5E'``%'`  '`$@O&`А 㿘@Nc@;E~T@OS @ @OF @ M @   "@  @   2O  㿘 @Nb䀧@@@ $`@@ `@@`@2O '`ݸ ] @3E~\d @&Q o㿠 @2@` % @@ `@@`@2O '` @&- o㿠@N aT`@@`& ` @/N~`J`@& `o] `2O`oW@ `@g @  @ @'*` @ ?c $@  ? @ ?:  `*`*` c :  *`: ` *` *` 㿠`.`-&@8@ % ƒ(O$@@& @2` @K`@ +`? 2` 2` 6@2`K` `2@2`K` `@ ?  `?+` )` 2` 2`  㿠@@M`-@ܐ@N` @ 5``*ON%@5`@s @M|t! :`  0p? 㿘@ N`@'`@ 7{N `O`@N @ e'@ `4ON㿘N  @ 7L@ O` "@ @O`㿘 N@ 71@N`@N㿘N `@ "   @ @ `@ @ ``#`O@  *H   㿘@N `@ 7`O㿘@N `@ 7Ԑ`O㿘 W`@ `@LL`@&`㿘N @% @7 @+* 7`E@@LINO '/ 㿘N @% @7 |@/* 7`@@LaNO '/ 㿘N @E @7 Q@4* 5@@L6NN@$ @7 0@* 7`͐@@LђNO '/  "@( J J`@ @ `2OJ  ` @ ``2H#  J`J @` @ J` ``H ` `! 㿘@#&N @ 7N`ѐN` @7 Ő2@&@' 8ON  㿘@/&N @ 7N`N` `@7 @@@@G7@D* 77`2@&' 8ON  @KR! ?*   : p a+  *``; `@ `@8`"8`::`"*0* 2 @KR `?*   : p a+  *``; `@ `@8`8`::`*0* 2 @JR#?*   : p a+  *` `; @  2H? (`1 @ `@9`" 9`8:" +`2* 2  @   ```@`` 2O *@JϞ㿠"@  `"@wt`/`7 * 62@% `2O  @JR!?*   : p a+  "> *` ;@  @JR!T?*   : p a+   > *` ;@  @JR ?*   : p a+  *`  3` 0?@JR <?*   : p a+  *`  3` 0?@IR#?*   : p a+   c*` 8 1  0p?3p? @IR#?*   : p a+  *`  3` 0?@IR"p?*   : p a+  # *` : @IR!?*   : p a+   *` ;@   @I!\@   `@ ?R*  :  p a+   *` ;@  @IR ?*   : p a+  *`  3` 0?@IR ?*   : p a+  "> *` : 㿠``@ @`*@`?@`[` `@v@7`* 3 `]@j@h``-@ / 0O] G]` @S`/ 0`* @ 6`H` 4]G׀4O` `+].3`]@7@5-``-@4@ O] ]` @$`* @ @1`@$@   G〣@4O`` ]`]"@.`"@ '```]O`$``!`  `\@ ```H @ =:`H  2@o  ```2Oc d @` ```*@ ``*@`*"O`@ @`?* 2``?5`\5` 2? 2p?`[ @+ @)"@  @#@"@"@@  @@@@2O @ @ @   `@@2O 2@   "@   ɀ`[ 10? 㿠..`@@*@?@[ @s @6 * 1`]@g@e-@ * 5 O󀦠] E]@@Q* 3 ``* @ 2 H 2]G؀4O )] ]@6@4.-@5@ O] ]@#@ @@$@   G䀢@4O ]]"@/"@ $`]O%"  \@ H  "@ 1 .H    @ 2@  2Of"@  *@   *@   *"O @*  3` @%* 65 `?4`\2 2? 20?< `[@=@; @@8'@ @@%'@@@ '@ @* @@@2O '@@'@ @@ '@ @ @2O '@08`@ ŀ`['@082@ "@   `[ 6 2? @F@Ⰰ@@N`` @   "H\`@@ @N` 2O`\ N`@@ :&\N`{@  ``@@%`*HN`@"@``@@%`@n  N`@   @[{@{@ }@Z @ ?V`"@&@R` "@O` L` @H"@ \@D @ =`&@`@@N`` @€ "@ @@N` ` @`@:@4@ H  @*O47E;9a@ @@F>4ᚔ   &@```@*ON`@@@ & @ "@ +9aĒ@}  @@%`H N` @Y{@H{@@}@z @ ?v`2@t`&@`@@N` @` @@U "@ @@N` @ @`@@`@@ O`  @@*O`%E'@t@@EԖ0   "@<` 9` @"@3\@1 @*` @% `(H "`% 8@` @ 1 @  @ @)&@ `` @@@!N`` 2O`&`@*O}N`@@ & "H &@ "@ 9a@ ݔ  &' `2H'` 㿘N`@ \@'@`. `N`O쀥\.㿈@E'H#d`#`@N` @ 9  @ `"@ `N`@ ` 2ON``N` O H,&@ eHO `@K HH#\:@5K`@5@!H$ %@ @D*@`    @ `HK 2OH,e "@ 9a@ < eԐ,% `'`d'` ?@㿘 @ E@Db\@@ @@D@ N {@ "@  @JL $@ @% (H)`<% `(@7` "H `3 \@ $"@-` ;"@*` ["H`& \@ {"H ` }"H@`"@ L` @  `  O`2H &$/`   ?@㿠@@ @D9 @5`@3`@Z {.@P%`@ %=`@%@H %@%l mL  -L?-L?-L? O-:@0 }L - *OL ' }@$%&@` @L &` o`o  O``/?@O/?O/?OO/?/  @@ L - (OL  }--`L {@ \. {. @ǀ@g t \ vL  f n r$@ @ @ @G "@<-`M-` @E "H1-`F-` @4 @ ""@-`=-`]@[@$@;"@-`2-`"[`(@-`,-`]@{@ }"H -`#-`-`L `-`-`L `-`-`` -`` -`-`` -`-``  -`-`` ` 2OL a-` f \L  n r t v$@ @ @ @@ "H5-`G-` @> "H*-`@-` @- @""@-`7-`]@[@$@;"@-`,-` [ (@ -`&-`]@{@ -`-`L `-`-`` -`` -`-`` -`-``  -`-`` -`` 2OL -`%@. } {.. P @ @?  cf *c`.   ? `` @$O  cK` ``{-@$O`2@--@c㿘O`@/`7 ..> 㿠@_@B?`!и  @B`  $O`+ b` ?` M  @ M  @ M  `2O @Bb@I  ` `@ &@! I \@ ! ?4OI  "H ``@BI,`@$O`"@, ,?b  @., 㿐@B`@@`; a?  @ `@`@$O@@ Ȓ  `7  b `$O`  `@􀤠@@``@$O``"H bR/ `  ?` @J` @  @`@ 'J` @  2O`@ K``@ @&@#`K`\@ #`'4OK`"H `@A `*@  @`@$O`"@,,? @  :a  @ . , ! `@' ` &`& `& & & & &  @㿘N`@N @*@?@ `@`7 N`LN`[@ @ `@ @A47 7H7@FL ]@ @ @ @A* 74` L* 75`L -@@O値 ]c ]L`@r` @@@7 7@ @@ H LD ] 4OL8@ ]@Q @O @ߐL, 75`L -@@Oꀤ ]$ ]L`@3 ` @7@ @@@  4OL@OL ]L ]"@L @ L ]O BN`   & _&  @@ -`` &  @&  㿠@   @@.@6@`&  &  @@ _: @> & & _u& & /@㿠  @ _& & & . 㿠&`` @@ & & &`` @!& @>`&` &`&` &`.` 㿠`` "@ _ J `@c @] Xy˔  @>_&` @@  &`&` &`^͐ &`@>   `&`& ! @ &`&`  ^ `&` &` @>!& .!㿠@> `  @@@/E?9E>?E@=~# ?n㿘@=ch7@@=O` @3` @, <`.O@.@  @ O` O /` . 0/`/`㿘@= @b@@!2@] ==t@@  q @  @ @ HY@  #@@9@ @@#E~@@=Δ ?@@1K @95#/E@@j@@@=t 1#@@)9"4@444444444444444444㿠@@ 0J {@ "@% (J {O @ @?% (`@.`"@  J?`\6 2p? 㿠@ .  0. @< cp @ @-E @<@<>9. /T$   g?`@< `J 2 ?`=`" .`@`) %H/ O @ -`.`@@ O N `@/ ' .  &OO 㿠@<b8@ @`@)E?Ւ ;`@@ @<`@#;N`   @`@ +@N 2O +@ -H@2 2? 㿠@< a,@@  @R@ `& @;9c39Ԑ:b`bl-E0Q @< @@ 㿀@<`8@;E8@ 2H`; N```0@5 ` H`N`  @ N`` @ 2O` 2H`"@ `N` @@`N` `O`@ "@  99"@    @;b 8 `@5p`'$N` @M@:cȀ (@@ H O (<H@H`2OH )@,@"@^ 4 `@)@ #@[P@:є,, ܐ@2@@&@$@`@ @ 2O@ \#`#\$@{@[㿈@:` !'!#x`  d% @@ #`@@"@( ``@7{74`@ `  @ 耣`@a @\؀@ "@`耠`@S @N؀@@ @@``@@``(-@@ @8` @"@L``( :@ L`:@` 2@` @"H`@a2@`@\ @Y``2@T` `2HN`@J@H)@E@C L``(@ &OI 9`@ @ 4  @&@'ZC@9Ĕ,`@`@&`   " %%  `@``@ `@&` @Q2@`"@D "@A @Ȗ @  d&` ``$`&`&`&` &`&` @ @`2O@`@% j% \#`#\@-㿀@9 d?'`@@ '` d"@  耠@ @- @( @  @ @ `@@ @   2@   2O @e@d`@_)D&``@82H+ a2@ "$%%%% &`%`@I&`@%$``%T@d 2H&``'`[`@+'&`?@% `@``@@ @  `@ VD   %! ` %c+`@(&``@#'`?@% `@``@@ @   @ V a% `  &` @&` ?&`@ "`2@ "```"@` " #\ @  @ ` ` @ 2@ !`! H@ݒ㿐@4`b`@@ϐ@  @#`+D |#\ @ ;D|J۔? #\@p@4\a@J@ /DԒJ?  $@" 8!  "D @- 0@&h@_+ @@%<- DH ! ]?` 2 "%#\"0 H@Y#\>@_ ?1``9 @ݐ#\?` 2 #\   @㿠@3c@b? `" @*``@'`` `@`"@`€` @ # b @) T) !'`$㿐@3`b`@@Ր#`-D#\@+ @  @$ %@;@!@#,@ %D%D#8@ ` @@є `  %@` -d@2@&` %@}㿀@3a@@``"@ @  @ @%@ @ @  @.TE O$@ &  &  `& @ & `@*` "@'`#\`@ '@  @   '¬ 2O h`@ `"H#```2O` `@`@@  @%`@"`@'`` @ @` @ ) "@3 S3 a`'`%` @ & ?&     @㿐@2/Dbd@#` #\" @!` @@)D=ϐS " ;f" `p" " &     @㿐#\#` ^ @9 @5  3f`p2@   2@ @  2O  h @ ` @2@  %   2O `2@  %$` ߒ `@@ O     @㿐#\#`  2@  `@`@!`2@` `@` `2O`` `@`@@` `2O`` 㿠@1c\@ @D}8 1  2@  `@O`J -@ :D=d @1ݒ@( 2@  `@%D%Dp @1ǒ2H @*,    &O +D }p@12H @", Ȗ2@ &O 㿐@1a@ @1D=t 1< @   "@7 )D#`= #\ "Қ  @e@  @  "#\` @ `&O#\  㿐@1` @ @D}@ 0 @)  @m   " "`@'` @ }C@ܐD=#` @  "#\Y 2@  &"@"  @ "&@ ' 2@  H) x a @@$) !@@@@$D! @ @  a@`@``'@ ` @- P- +@0t%`%`Qr`@9 , @$#l`l ` `@`$? "$?  ! $? ' $?O%@@`$ ` ``@`$$O`%`"$ #\?@$ː @ Ȓ H ` D (@/#|@ D~ / +'Dc0.I "@ `@#`  #\ C @ `"@`` @ #\ @* 2@`  `2 10? ˜@ ?"l @ ,  @ D~8  /[ @ @@` ` @  `H  +'`O   @ #D ~L/+ @{ @˔2@` 2@ $`@ @2O' PF @ )D>` . 5 0p?P % @ D>l . @  @>?  @#m  $`+@@c ``@``( @?@  휒@ NzΔ@6+'2O >`;?  " `+ 쐐@0 ``@`(@"@   !z@ *2O `@&Y@$S`$`z+@9耠`@(" '(@ ` H "`za@z[@耤&O`?$`@$ʮ `?$`?@$@&  @ '-D . @  @ J `2H`/DB cк, "@` *W԰2H+  *P԰@~ @!  @`( "@ ?@  c?y@O*<԰2O ^   ?`@9` (@@   @ H "@@-ޒ2 2?`u WH @ y@ )2O  @&U @ 'D -` @ @@` ` 2@ '`)̐2H   ` 2O```(`@@  ?ڮ @ #D~А -*  @ѐ @ D> - @ `)Ȑ"@  "H )2O ] @ -D , @F9M ``@ 9 $ P, $ `/9X $ 9\  $ `)@ $ `$ $`l @9)b`@ 19Ԇ?M[ #`S  9ㄔ   % `@ #D ~, @  @   2 0? `(@# ``@` (@@  Q@ Җ 2@ (ߐ2O  㿈@,a@M)@% @O `(@' :OO 3!Dc4? @ @ @ D#`#\ "@К " @ @Nwߒ"@"@ʐ0D@ "?@3 D?@ @ @ @#\:#\#`@#\`@   &O ` @ @  @"H ?3'Dc4D@@  @2 `&` ?&`L` 8&`& 㿐@+ d b@@& dD#`P  "#\: & dD#`P #\"* 2@` &@\`@%DX``(- ;@``@ @`@9`@ D@,#H9ܐ??`  `/ @ D@  @ 9 Ɣ   @ #:`,5  @"H5:2@   " "@@H  \  & &&&    @㿐@*cԒ@?@+  ae? ?" #` #\`@$ @"@ @ 7 `"@`K`$$`㿠@5@@1@*b @@ Ӥ? @@1D?Ӛ `@?ӓ @`( @?@?Ӂ㿘6@`d@*Da@@  *H  "@D   @??   @N J  @ `K`@K```2O`@@#`@@ K`:2G#`K:2O#``#\  #`m@ `@&O  㿐@*`H@@  9D? )7D ئ? "@#`##`#\ | @R"@\ `@``"` "`@#\Θ 2H`d `d`"@-`"@)N@ K  : @:@ K :@ K   :"O O #\  #`@`@&O DcL @ 㿐@)a@@ `@?@ ?'@H %D )= @ / ?` @#\{#\#`  `2@ `4O`  @ JN @@ `@"` @)`L` @H@` !$` $` @ `@&`   hN`H`( h  '$& h <`@  hN`@`(@ I  `O`(   h I @I  2O I?`)@  h! %H,%,O,. h  '$& hӐ`@V`@`` @Q`' @L`@"@  '("@(@g(2O 1' '("@(@(2O `' 2HA  ! ԐW\ h  '$& h}`@H)' `@ {!``@"H$   '(@"@(g@(2O Z!`@U  '(@"@(G@@ (2O  ;! ~\ @-h0`@ ` HCh@;C|+@C  +@(+@;C+@|, @ %@Q@J`!&!`@`&`"@`F,``$`$`$& h3 㿠H^ "  " " " " " " " 㿘@'b@ݐJ s@&L -@" @(  @:N-@` @ %@'@1ŀ1#&`@&`&`  : @   㿠@'9aĮ#@@ܒ"@ @'@-:#\@ ԖS`"@ 7:@@2O7:ؐ@ < 㿠  @  HR&   2O 㿐 P q @  2H *Z@a#j@?   & " Q0  @$&" &   &"@  & 2O @ #-2O "ې㿐@&c@ `@@  A B@2H @)@a#@ 7 -  @ `@%``@`@@` 2@ G @"(G`@4  " Ĕ#\  T@%1 @  % 2O  h`@ `"H#```2O``@``(@@@%`@""@% @% @ @ @ @G>%$%% `% ? @ %%%@G%"c2O[ "㿠`$`@@%`(c `@  @`@``@&`` @`@ @` @F`!qF`@!#\ ` ` @  $`n` 2O  h @  @"H%   2O `@ `@4`@A`@,``@(`@"&`` @  @` @   `@) F`) ! `# $``$`   $`$`` $O|`㿐@%a`@ !@t  ; - a `@" "@$ @% @ `@@ @`@FK%$$  $  `@, $ `(@@ #\ #\   @  $   2O  h @  @"H!   2O     `@ $  $ ?$  @F!B2O  E㿠 @``@ `@ @ ` @ dE @ @  @ `@ @  @ KEȁ㿠@$;:bh`@; @` ``  㿐@$5Caܮ8@#` #\  j @``@`"@``"@ `#\ ? ``@z    @"  @$"`P  Ȉ"``!`"` 㿠 `@ @ %@&`2OD& @$.& D & * & 㿠   & @`@@    ?" @@    @# d"`#h"``!`"` 㿠  @+@# c @?@'  5 @@`"@ @  @ 3 b@"@D' $DÁ㿠@# bT @@;$@#D! @#-@cx&`&`&` 㿘   @ @##Ca@|@@#@C& &  (@#x )@- @#n,,㿠 @# `@ ?   @# 6@ @# @#ݒ  㿠&@#` ?@@# &?㿠@& @#H ?@@#m ' ?㿠@$ y`@ @  @#@ @#Q D 㿐   @#Ж 2`*0 `>`@#> &?s`2   @#*0 2`#@ ` [` O&2  @# ?` @#sh [h&㿘 6.p @@#2 2`*0  ` @# s` [`1p '  @"@ "D@  ܂ @ @#@$_ @ @   "n㿠@";Ca|t@g3: a@ %C]xY!@  )CR<|N @  -CGC @@ = :X@"`@@"B@"?@  C|@"@@7"@  @ &  C @"j@;C|@"b@E9C<Đ @"Z@, @"ے̔{"@/ @ / d@  /z`2>K 1p < >$@/ `@"́ @>C|В@"&@6ȖĐ܌ 2@ȁ 0-` `@`@1:" Bā  +`@"Ȁ@t ;C |ܸ@ 9Ā @a@!@"w@ @ '7 ?'3@!C@"_@ @`''@!p@C@"G@ @ `{@"; `z@"5 Ȯ &O `@ %:PĐ- ?Ԗ?* BHā BD  `@"B<ā @9C<@!{HV-C )@!C ('̒Ժ* '@!@;-C@!@/'/  C<@!H':3 '  C8< @!Д@ `"@L ͖  "@C $@Ė   `@!́ @!2@07C @!̔ȖĐہ 2@ȁ @``M /`J / @!Aā `@1:! Aİ 7C?P@ a@@ 'C@ H`'C%C@k @(@@ ~]C=4@XB/ @-C @@ @ /C 9C @ْ=(@@ Y8/C`@ "`/C<@ @ @`  @!tCD@@ <C}H@@ 3`@``@/C=L@@ h@''pb  @   `s@ p>- >T CT@ @ p C}X @@ݐ`@-C\@@ 8@  ` @ llY @7C h@>@`" ``@ ` "@ 8`@ # @ O (`@`" `@ ``` @ ```6O* x9@ Q@ [5! @@ !"@ e#"H o n`0/"@  s;c@ n`0`0 m`0@  `@@ `@  "H `@ @&` &`&`&` xܒ@ n`@ i`@ `䀤 n@ `% m@ ,@ s@ o@ ! `9!`)!``@  `@  0`"H ` `@ |@'`@֐㿘@/CcT@#\@  @EN@ @A-C @0O@ "@E 5:p`  O& `@ `@  "@) ;ap3:b  "@ %p:"     @ +ap%:xz  x?  4 @``@-&   `O# ܀ @ `@ @`H  &  '''`'// @ܒ`@5h@`к@"@   "H  "@ p+C_M@ @%C}Ē@ @A @F2 2?` @  C؈}В@@.`@ @@ 7C'ؤ @@  ` -`@> ' ؐ' ,@-' 5C@>Ж H" /  "@  X4::c@@ } @` @D'@7b@@@0 '!C= @ ĸ@@ '`@@  @ 쀥`@@9/C#@> @@'``'`+'` 㿠 @ `@ ? &     `& @ @ @ 㿠 @*?2H @"   @ @  @  ? @ @?@` ? & @@ " &`? 㿠&Β"@ ?@! ?@@r @ @j &?㿠&"@ ?@ ?@@Q &?㿠@ @`@ @@ =㽠@c0 @@' f @ @]O e@&/C@"@? ' c@6@@  '`"@ɰ $? O p@C@@ @@3`"@ V:#  }  O  s@)C>(@۔@ @t6@Mx``H` @q@3 C>_I#`@g`V @w @   ?Hݮ #h@Nh=J7`2HU : @0@5-C4'#\@/\ @? @   ?v #d@d`2H  `"@ 9:VV#$  H  7C@: @`#0@ @  ܂ @ @0@ " x@b@@@@@@   @ @ @8 Oː@ ?'ܒc @` @ ?@Q'ܐ@ d'I `@ ?'ؖؒc'ܔ @G @ 6@\'6 \ "@ ''ܐ@  'ؐ@ ?@$'ܒ@j @'ܐ@  ?'ؐ@ ' @X H%'@ @܀ H @ 7:U<  @̐ 'ܲ ; " " & ; " & @ @ @ ;:UjcT  Ȑ @# 9? 6 .`.030@6 '(( \?@?@'@H   @ `@2 " `"@ 7( `"@0(&  x@#\Ĕ 2@$  9C$ض>T5@`/C@@)C\>l(Ȗ $@@; 2@,   @x@;Caд~x@/; " `" +C'C" ~" ؒ@ؔ('  ;K 2@  ,`  x@#\a@   2@%  5% 1C @>-` @@@K @ؔ(V % `@ '`H @@4@0 @ : 3C" ~" -" `)C" !C>@Ĕ(% $`>`:ݐ  @ #\@\`  㿠@ c<@@ H'  @= ;C~Ȩ  N   @ 2`*0 `  @ @  -: l4  @ 2`*0  `  @ @  1: #t   @v 2`*0 @`  @ ` @  : |@ )A# @  'C#C :P 9C/C+C$9C:E?0 :?㿘@`@'@w@.@ +:c-  ;(c@@ @ @ C <@@HK!:( @C :#Ē-@ 7:㨖  5(ѐ@`@@ `@ %C <@H!:(̒ @;:cȒ@@ :Ә  '  !:# Ƙ   @!sب=t  ''@' @ >!H 0 л="@>'@+$@,- &*#@ +  * @ &@+?/a @w @CD Œh  @!4h  (@hЦ@`#\@@ ``"@@K\@r@Ԁ @m@9􈥀@% ? &@w''`h@$`h$@$@g @`@@ @ 2H @#@" @ 2O`7ж@%'蒥@''@'쀠@w$`hh$@$@+` G‎@ @ 2H "O@6 @%&@w''`hh$`@$@ @`@@ @ 2H @@@2Oj`5ж@%'芥 @''@'쀢`@@w$`hh$@Ƙ` G個@@ @ @2H "O@7􆥀 @%&@w''`hh$`@ @`@@ @ 2H @XG@T @O2O@6􈥀@% `&@w''`hh$`$@c @`@@ @ 2H @@ @2O`9ж"@% '败 @'?''쀧 @@w$`h$h@*` G倏@@ @ 2H "O@9 􂥀@%@`&@w''耧 @h$h@ @`@ @ 2H @G@@2Of@7@%?@ &@w''hh$@ǘ @`@ @ @2H @G@@z 2O/@6@%?@ &@w''h$h$@ @`@ @ @2H @J@I@D 2Oж@%'蚥@''@'쀢@@w$hh$@U G`@@@ @ 2H "O\`@3@ @$@h$h@. @`@ @@ 2H @@瀦G܀@ @ OӀ@2 `$` @h@$h@ @`@ @ 2H @@G@ @2O`b@0`$`hh$@̘ @`@ @@ @2H @@G@@} 2O`2@5`$`h$$h@ @`@ @@ @2H @UG@Q@L2O`􀥀O퀦@#`hh$`$@$@e @0`@@ @ "@$ `h$`@$h$@D @`@ @ 2H 㿈@З> J 2 @>> %,%-`,&)`$*`@) @@@-?/@b@% '@ 6@'耣@ @ '   @ @Ð㿠UU@㷠@b@@ݒ@ @  ]@@ " @ @@ " @ @=@@5+C%C@@*@@@!@@@@ @G@O@ " @ @@ " 9C?@v@@ "  Uh@h@ U^h@)<'@@ "  h@a@ <  @@{ "  @T"@ `@q "@` #<- @@ /@*5"@`(2+@7(@*h@4$?@h *h@.2 `(@+@ @ؔ@"@ @̔@㿠 @Ŕ 6@ @#6@X@a 4F?@ܔ@ @ @֔O4@E@C@@ 2@ @ː 4@2@0@ 㿠T@㿠@2 30?㿠T@㿠@ @!/@@2 30? @a8@Yt @,v, ?` @ '`   ? YZ@X\X ?`@ '`3  ?3~,X@ ,}X @ ?&u &Y$ @,&, m?`@ '`,  `?,X@M, @ XW?&EX`&@ c@@ h@@ !%?,@!@ @@ @  ]@@ " @ @`@7 @@ 2H `@  ?_`@@ے@h`aШ@@@ #< @@ h @@ h @ -Cє `@x;C Ȕ @u@c @/ L  .2@ L `@  C@S@ Ҭ?Ҩ?@@^[@H2OL 4L .2@ L  @' C@& @  ?{?s@`0-`@@>  @2OL @^@@S @' O`.@`O`@`+C@ @`=?5@5@2OO`,O``.@`O` @`C@@`?@`͒`@@ޒ  @2OO`@ҽ@h @ @  ?9@㿠@ `H`"@   `@  `@  `@7@  @ `` 㿠@ `"H `"@   @   F @  @   ޖ 㿘m@V@ @Q"@@ @H''@N2 30?0@hcl@@@~;;K;/;`(ǚ  @2@  & ?3?&!@) 0@hb@@U@}ː;;K/;`,@  @2@  & X?&@ @ha@@"@}/;Jː+;D`XW  ;?3C.`@r`Ȓ?& @` @/@'}$ @Cј$`2@`@}Q);%;#\!; \|  'Q4@r?@@ }4;;Jl3;``   @c @ܒ@'}-$ V@E$`2@`@D|);%;#\!;  ˜ 'P@?@*@ |;;J3;aa    @bX @@ ?(4'|`@:"@x|I;$; !8t  %?,@ '@D@-;);o<!`  P}@@ ];;||adI1;!l   㿠@;C`ȸ@  " 㿠@A @z   L   s@T@-@VS"HC jN`T@Lr"H cN`w@s@&t"H=ZN`w@x"H SN`@P  !@)4 @G " *@+@?  &- # @6@4 ! * @* @(@&  "@)@ @@4   ` 2 30?   @' &OL& N``@ N`   `@k  L @o@ a"@Wog"H d8`o"@Obu@`iJ H `@/@+@ -H  ="H      4   0   , t@ ,@#rH s"H  t@wH  x"H   !$    I  ,   " ,@   K O@ H @"H=` @@& > @& @ @&L`Ow  {^J /@ 2H!M @ْ /"HM "( x@-(@ N `/"@6O(/@0Z(M /@@"G T %Z@F IT@  M @ M @(  @@(H0@ ِ(,@(@ ޒ@  (O@`@ ((( |O@,@  (&"@,(( @(X@ @ 9!# `@,N`@ /@hKO/5C@ϐ@CN  ; N `@; 1C; ?ȰN '-C `+<` @ @`: N ` @ N  ` 2O `:@ `@ , N :@ 2O ,q @,&ͪN?`/@,C?̒͡ ,͝?@z @D@c@? @2H`J 2 @=>`%@㿐@& &  @@p@㿠N@c %@V@N Q@S/B'l8` `@(@@%8`zJ 2 =8`&@.%@- ,@2@ z8`J 2 8`=`$) $* ( @0` 2p?  .8&@9-`am: J /  (` -:``@2 <: !@? 3B|x@@@/B@@ @㿠@;@aa0@ H@㿠@;@aa0@} H@$@㿠@;Ba |@@@53B|Ȧ @ @Z@@ @/̐̒ %@@9$ $@@aȘ , `%&@a# `"`㿠@; ccH@    &@͖ *0 2`` @; @%B0@e   @*0 2``  @& @+B<@P   @2`*0 @ ?`  @ @1B?H@; @#㽨@3;b\-B@`,p ;BT b@);"@@ +BJ @ +B? Ox+Bp@ݐ  E?`@1 O`@,? OaÐ`@)`@@-",0 OAī,$[ @, ' #Ǒ,  '`@9`  J .@$1B?|@E@ #;B@@9 @ ?'-   ' ,`#  '`@&O`@,`  $/,&\0 NݒG`@,` @ (` %A0 N’,`@n1B,`? $, #?$0 N @QB*  ڔ(` %0 N`@4-`@?&?*@$?0 Nmא @*  +`%0 NRü#l#j!!K @ %? N=qå @9B`?@@ @)Bž,@ 1,£?,N`i@MN` s@! bN``o@HBN`-@C,J`@J,M``+  K @AM+  K 2OM8 @+BN`m@'BN`$`0 @!, c pN..@$O +`K`@K +` K`2OK H BB@@ B?  *H+>" `@  %> @ϒ@ ```2O`-   ,`2@ )BzB,)B,rB?@@BO `@>B@@-BO @>-B@ې@Q'BO @M'B>``@ `)> "`@@  2O `. ``@-O @&.@ O  O.'BO  @ XX?X H“X'BXB'BВ B7 @  @7Lx f B@*"@*n@"'TTPL T@ P @ n7L Px`|MT&OP %@!B? - %@;Bc7@ᘒ/A+-  b'A$ AA4( ! @'@X$ u? AA<<L $@ .@,O)  ` `@#)A%A@!2@#3j, X?@!G, 2@3@{;;i/;b$<@@ƚ  }@&& @,bȒ@ )?@U@#X;AX}( X$?@CX,@8 @9a@ @ ! @ @`@@"@ 'd 2@'d 'h.@'l 't+` 'pd'x'|'''`&@@ +`` @ O+`'IJ?5'Ȕ?7̖"פ '''''''@ ''& & & & & )(& @@ &``<@'Ȑ&i &i$&`@ 'x`@ d@w @# @'@l @$$@x@$ @#x`@'@Z@$'@ 9 @$ x @@Gx@c|`"@ x@@7@x@@0xĒ e``@Ӕ p'x`@@!@cx@@x @ A}@@q@#EԒ@ , @ @ & '@ :@ K @?A=@@XԒ@  Ԑ@ P x& @@ -A DȢ@@>D@ J OxH1M` @Ad/%}@@!/Ԑ@  x @& @q@  D@ D&Ox "@Ԑ@xL@d@ "@x`@@@x`@;`@!x`"@@v?'d& &`|&` &` &` &`'&`8|@%Ԡ@&i)Ԧ?h@&i&i '@&i$3`@`@ j@H @D@?x 㿠.` 8 0&6@^.@ e 4 0*@ݐ& 0.2@ & 0 e & @ &  4@@,`@$ 4`@ & 4$ 4 & 4*O$㿠  @8@ 0"@`` "@p@p`"@t@ Ȑt "@@ 1 "@@#X "@@#R "@@#L @ e@ & @&㿠`@%V`$T` "@`V`&@``2OT` d p?@ V`$ p@ V`& p@  @  ` @ @  2O  `@%`2O @"@j@ @  @@ʖ@^2O  & `O㿠 | @   | `@    n @ @ %`  2@| @& ` @" ` @p ` @ ` @  2@a @\ %`  `2@U M`J *` *` @)08;8 -`O`+8 @@@H`M`(``@@ H`M`@(``@2OH` |@@ UO  @ e & @ & @@ ` %` @ O` @` @ '` `@ '` =/` 㿠 = @ g "@  |@'@$e@" @ @ ` 2@%  `@ @v `|@@@`eO倥 `@ n a& ` @  44l\P,㿘#\@? "%$W@ԋ(@ ` ^ @x @ r `V h@o@ l ` $ @g @ a `V h@^@ [ ^ ` @V ^ ` @P@ M $ ` @H $ ` @B@ ?@`@ `  @ r@| a@@O@ ` `@o r@ a@h@>@ ` `@^ r@[ a@q@ ` @N r@e a@G@@z `  @= r@U a@P@j ` `@- r@) a@& $@ ؐ@X `@U ` `@ ) L@5@ Đ@ @ ` L@  e& @ &   e& `@ &   "@    e& @ &   $@S `@ d `@Ѳ @    $`@@  @@ t   ? @@ V h ` p d @@ b L@   $2H ,   p 4`& ,@ @@ J@ `@ ` `@ ` n @< ` n @6 `@z ) pf@ )  @n@X.` 0 ($@M` @] @_" " G L@ e & 2@ $ $ &  4*@ 0  e $ 4  H( e@&  &  0(@7 e 0@ H  e@,&  & @& b @ $ n "  `@И@ ͐ `?@`*@ `+"@ x `?@`{H$q  $  !2H @ R  $ !`2H @ _` $   `2H @ = @ @ ,@!@  @ d@!@$@  $  e& `@ɬ &  "@    } }@   e& @ & @ e@` @`@@ʒ(@ 0.`& ` n @ `@N  `@(@@b@>O`M`@, ,   `@1@#b@"O`@ , , `@@ H `@`"@a/`@/` = @O `@Q@ `@ `  @H `@ `@ `@<%`%`@q `@n ` `@1#` n  `@ ` n @ܘ  @ `@M`@ @ * *  @  .@" O` =`@'`  .b/`@'` ``@` 0`.`  ```@1` `@"@ ` =b` n`@ @M`@ @* *` @ ` |@ǖ @ɶ" `` |`@& `@` = `@&`  @ $  b@# n `` @^``@5` 5` @M`@ @, ,  .888-`E`@ @  n ` `@89``` `@ !@!``?@ @M`@ `@ +  ?+ ` @ .@S @U`  =@I%  `@J%&` |@\@e@ \`Ś $ L  ` n `@` = @"$ L @J  , , ` )p8908, O`/ : "@ ` .`.` @ (8;8 /`㿠 ^`a@` $ @` @`dl@l  ``l@מ㿠 d@ /` $@@ -@ d@`O/` eH  e & 2@  &  @x4xx㿠@ !4H !@ /` 4H /`@?x` @.`@@ `@ ` n @: ` n @3 Ș  @ n ` @#@ `  @ `@6 ` n@ ` n  @  `@ @ ` `@w `@ `@  `@i?  @` n ` @@e `@b ` @Q ` n@ ` @Δ ` n @͘ ` n @ǘ `@ā@C `  @2 `@ؔ `@;  `@$?K@+ `  @ `@ `@#  @ 4  e& @ & 㿠@ ]@ e@ @ `]@`eO ` d@n㿠@ `@ ` `@֦ݔ `@@ p `V h@] @Ĕ ` d@" @ 2@   `@ `@`d$` @  $`; d ) `+`R @ @@4 `@@ ` `@ `@ `@| @  `@H `@ ` @  a ` d@ÚL @q `  @W `@  @M @ @@ `@Ҙ ` @̘  a ` d@  @ W @@ `W @  2O @ `@g @`4Ok` `@ `@o `@l㿘 `R@ `C@Ȁ`E"H `I"@1 ߄ e`R@`p"H  $؄ e  e& `@ؚ & 7@q `R@ "@@$@@$@{ @ @ @   e& @ &  @@a `@ R@F@9 `R@`p@`I"@ 2 e $7@+@E  @ @@ @  e & @w &  @p@*  @i "@  b%   & @[ &   @[ @O@Ė@I@ @   e& @> &  @7@  @1  @ @)@ @% @   e& @ &  `@  `@˒  @ @ & `@ & 㿠@ `p@ @ p"O@㿠@  `& @ ` & `@B` @> `$`$ p`@2@@@ ` d@D ` @e `@[ d` d<  -,S@3 `@) d   ``@H `@> d`&O`㿠 `@ @ d ` p@0@@㿠@7@  "@   @H@ @ ```@ܒ  & @`$@%` `  "@ d@@ @@@(  d@Œ ` p@6O ` @7 `@@+@ٔ?@@@@@@`@,2`@@@?O性@@? 6O "@` 2@ ``@ " @E p ;` d ` (@/ S@f@ @ ` `@z `@u `@p @M  $  `@g ` $ @a ` a d@) @U4O``@N `$`$@ d@? d=` ``-@ + R @@ `@ ` @- `@( @#`<  d `+  *`Q@ `@  @``&O`  e& @ &  @? @?`@ @ @@ 6@? ?` 6O`  㿠 l`@@؁@X `@U ` `@@@ː>@Ő "H& l㿠 x`@` & x /`q D"@ e t'`@& t/`/` 7`7` '`'`7`'`'` '`'` & @ &  㿠@` `"@```@@㿠@`"@/`@/`/` "H x'` & x㿠@` `"@```@`2O` 㿠7`` @ ``@7`㿠N `  @/` "@```@O`㿠 t @  @J `@2@^ 2O @& t& x㿠` `@``@@h"@ d@̚``@-A@| 2@ܐ d `@ @   `@b` `@ @@Ē @`@@(㿠 `@ `z &   &  ,,  &  &  @ /   e& 2@  &  @. %%%%㿠@  ` `@@F D6O ȁ㿠@"9?`"׀@`'`'`'`& @  < `"@) א ) "@ )$ `@@ 㿠@;A@~0a@@1@ @@h@̚aD@;A@ 2~`@ @@L 2A> @  @ @+A 2H,  "H @1 2#A~@ "H +AH+A~'A@ @Z@z "@ P  @J㿠@퀦 bL@@;;b@V @ 1A>Ȓ@9A>̒@㿠@3 `@ @ & (  n@ & ( n & ( n& @9,@X㿠 `@``$6 :@G ` `*H> ` *@ *@  ?H  e ="H` :"@`" e`'` @Ǭ '``` ````'`?'`'`  ! ``'`'` ``'` `@ '`@ @`%4<` @ `(@ ?@ @` `& ``'`@v eq@_`@?' bᰚ @K.  @ ` '`7` '`2`  '`,``'`'`'`"`@ '```'``??'``?'` `'``` '``'` @#2O` `` e'` @ '```@ e )@  `'`@ '` e`'` @ '`  " " " " @`0  `ppp l<㿠  2@ @  `p@  n& @ $"H 6 $ A&   `@   @ @  & & & &  @ (@$`@  $8@ @   @'@ ? ("Ī `@-`ŀ e&    e& `2@˰  &    e& `2@  &  @? & (, " $@, @6 $ p&  `6@`3@`1@`,@*`0"@# dp e&`1`(@ dj e&`3 (@ dd e`9@&`6 (@ d\ e`9@ `\H; `}"H R e d& 6 $  ,&  @   & (@ }  @ }`?@   }&  `' & 6 $  }&  6 $   e& 2@I  &  @ e  @ @ e`}@ `&   }& & (  e & `2@-  &   & 2@$  &  `\#ވ @`-@x`["@ ĸ p`\@`]@ p [@ p& 6 $   @ ] & & (  `@ ` `@Q p `"`  @@? e@: `p"@ `C"H $+ ed@ sH.w"Hr e &  @ &  | &   & 2@  &   & `2@  &   & 2@  &  6 $&   `[@ p  @@ R`]@ p R6 $&  & 6 $  @ @  e & `2@  &  &`.@ `=H  `:"@   & ( I&    E& (`d&`&    C& ($&&  6 $'` p& &  & 6 $ `.@ p  @ @ p`]@  & (` X&  .& 6 $  p& 6 $ `=@ p  @@ p`]@ `&   X&  =6 $& (  p& 6 $ `:@ p  @ p`]@ &   X&  :6 $& (  p6 $&  `?@`*@ `$@o`("H `)"H  p`*@`+@8`."HZ . p`^@ `?@L`[@`\"HZ ڒ p`^@M`{@^`|@Ґ |&   `@ *   @ * ?@   *& ``#`& 6 $  *&  6 $  @ +  @ +`?@   +& `%& 6 $  +&  6 $   @ ?  @@ ?``?@ `  ?&  "& 6 $  ?&  6 $  ` "@ @!  :@ b@    {  & (&    p`% a&& 6 $ `@Z   @U ?@Q `$` &  & :@!@/#"H 4 e:@="H - e6 $ (&   @ `)@   @&  )2O  &  ` L  `& 6 $   L``!`& 6 $  & 2@  &  ` (& 4` 3p? 6 $ (@ )  % & 6 $   %0`@>``@: [@6  :@2 `<@`>@, :@( `]@$  ]@   >&  &  :@ `]@  ]@    <&  `# &   @ & (`^@&  [& 6 $  [&  6 $ &   ^&   $&   Ƃ@r` @Y@ː `@K e C2@r  $`d@ `D@`SH"`(`W"H)`j2 e`d@ `sH``w"H`R( eҔ   `( `@  `j ` &  "O&  & `2@1  &  & `2@)  &  @  p ` #` !"& &6 $   e& 2@   &   p& 6 $ $ll <D\|,㿠  @& b@/@ p6 $&   &`0@? Ip$ @Z-@ @ 5 p& v` @i 6 $ 6 $ A&   p&  6 $  p&  \6 $  `&`   @  e & `2@4  &   p&   '  *01p06 $   C dd&& 6 $   C D`#`& 6 $  ; p` `& @ 6 $  p&  6 $  <&   >&   p&  6 $  p&  6 $   C s % & 6 $   C S%& 6 $  p&  6 $   @  `@ p6 $&   e& `2@  &    @   @ p& 6 $  e& 2@  &   p&  6 $   C w$$& 6 $   C W&& 6 $    b#@  `@ p6 $&   e& `2@p  &    w d! & 6 $   W$"& 6 $ 6 $ Z&      %`& @  @*  &@3;`@ 7` ,$@ &    b` 6 $&   e& 2@+  &     b#  "&  @U  `@ p& 6 $  e& `2@  &    e& `@ &  LLLLLLLLLLxx㿠 @O   @@J  `#` @ ?' 0"6@4-@?Ѐ@@`&@33  ,$  @  @  @ @ @ @@3 6`J @    Oɐ  $  $`@& $ & @ e & `@ & + 6 㿠.`7` [@ $@ *"H  ."@q . p [@ \"H  ^"Hj  pn@ (@^@ *&  6 $ p&    !@2 :` @:  [@6   :@2  `<@`>@,  :@(  ]@$  `]@   >& `$`&  :@  ]@  ]@    <& `%&   @ & ( ^@ &  [& 6 $  [&  6 $ &   n@ ^&   (@  ^ `"`&  6 $ p&    "@ @  @ @ $&  $5=` @ p``\@ p``)@  $ !&&   p& 6 $ 6 $&    @  e & 2@v  &   `& ``6@`3@`1@`(@3`)H7 )Q'`1(HD K'`3`(H> E`<@`8@'`6 (H4 ;'`8(@. 5`<@`>"H  `{@-   {& ( `# &   (&  6 $ & 6 $   <`%&   >&&  Ђ b  6 $&  @  p  " `a!`& 6 $ 㿠  @&@  & @@`2O   @#@ G& ` GH `& 㿠 & @   @& .5 @ U  `@.6 "`@(v"` `"`?d"` d"` 2`"`2`"` "`$j"?"" "O"d fj2"2`2O2!`!`㿠&  @#     @ - .`` 2@  ` "@    O-  @ց㿠. $ഐ@c c@'`?6O`c c"@&R  .@-@ "@&&6O㿠 ` @2@06` ` , $@@@ W` ,+  `@2@`"@  e %  ` 2@? %`?@t"&`.V@6@? `"@ ?*:`㿠 ` @?V``@ (``@, P6`@ `` $@ .`@&` -@2 ``@,/`*@`.*@+&`/`+`2@&`` e ```2@ ? &`?` &`&` , @*  ?0 "g ` =J 2p >=%@- <㿠@n/`  @.`%` "@ %` @@P@+ @) @ `@ @ & +,@ 2OV @ -  @.@U@ 6 - *@ R`6 O-  @/-  +@V`@' @@ /` (@W`6 `/` * @Q `4O V "g5` %@= J 2p =`= $6 㿠$ ` @?*   > .@-%@> $` 㿠>```/ -U@@$  @* ;@@/` ,` , # " )`   ?㿠.` @/ R@`@.`:͐* < ?@?* >`5/`@- 4`㿠@@5`%@& d p ``@@@"4O d&a&H d@aaO@@ d{ ` p`@@$O d㿠6` d -``dT *` @C*` @= /`@P@*  ` p? @r4`a@T"O4.``'@@.`-%@"*``!ك/`.``'@,@-"@!@(`@%K* `9 / (```@!"@ m5`5`5O5`# $` e"` `` @ !`$ ` p@`&!&`a%㿠` ``-`- @N$  ?2@DV@?"@>`@%6.`(3`@`&3`#`#`@ `&3`#`#`2O`.`*@ 2  "@    @  2O (O R` *@ *"` R` *@ *` @`#`"`@@ @ `@`@ 2O` "`:` ` `* `)  P+ @ +`@  @ R`?2 0?`㿠` `- @,@@@.@) ` `2@ `V`@@`@ ` ,`@< *O` `@?@@ + :`O܈㿠` ``,,@@@-@(  p`  `@  `, @; *O @@`@@@ *:` Oވ` 㿠 42@'` '`?'`'`'` 7`$7`&7`(7`*'`,@ @'` @ >'`'`0@]'`@Z'` "@` @3 ` p`^` ^`@Ô ` ^`@ ` p` ` K` $` @ `  $`@   @@ 㿠 `@ "`"`@m `2O"` `@ ` & @{ `2O` & ?& & & Ɓ㿠 `@` &   2!H@ e'`'`('aD & '`/` `"H& '`'` '`'`'`'`   "@'`$'  '`$&  ,%  ,` @ %` 㿠ʐ2H. 㿠` `@@` `O``@@``O@` ?"`*`"@`$`$ $`$" `$ "@` ` ! "`$" "`$ "` " 㿠`( @  P`2O & & & G㿠`@` @ T`2@``@.``2O` @) ,@"" 2 " "  " ' " && '  p@ a@ rH  0`@ 㿠`2@DaD @ .`,&aD (l!@ e ,"`  ,` 2@-  !` `(a` `<`X'``t`&`(``'a`a'``'`'`'`'`'`h'`L'`0'`'`'` '`<'`X'`t'`'`'`'`'a'a&`&`㿠``` p@a@r2H   0 2@  Ò @`'  @@@ `@`@2O`# ' ` @`'` `@@ @2O`$`'`&`&`&`&` &` &`'  `"@ `@ 2@`S` @``2O`   `  Q 㿠` `@`` `2O`㿠` `@ `ܖ``2O`㿠``@` ̔```2O` 㿠``@ ` ``2O` 㿠``@ W```2OW`㿠&@ &&`㿠 @"``@`'`@ @@[`2O '`㿠@2@& n s@&@-㿠` @&@@'``@ ,`@   `>@ ,`"O 㿠``@`&` @    2O 㿠 02@V$ 6 $ 6 & 6 ( 6 *6 $V&6 &V(6 (V*6 *㿠@+@;A`~ж@5A-A@@?@)A@?@@ݐ@@@Ԑ @#@@ @@@t㿠  `@E ,@;` ``@.`` ^@ r@`2O`"@Z2 ` 2p?@ @ , "O`2H!`@ , "O` 2H`2O` 2H ` 2H`"@ ,`@@F ,`O  @  `@ p``^@ U``` /`U$a2O`㿠`` @ْ L"@ @̒  $@  ,` @ >  `@4`@$ @( H H! ,2@! ` ,2@ ~`2O` 㿠  `@E ,@;` ` `@.`` $@ a@`2O`"@Z2 ` 2p?@ @ , "O`2H!`@ , "O` 2H`2O` 2H ` 2H`"@ ,`@@[ ,`O  @  `@ p``$@ U``` /`U(v2O`㿠`` @ L"@ @  $@ѐ ,` @ v1Œ `@4`@9 @( H H! ,2@! `   ,2@ `2O`   `!$(@ @P "$@& a@  $ @ `L "@   ^@   a "@  p"@   r @ ba @b$ "@~  "L"@y ^"@jR`r "a "@m "p "Hh "r H_a $@%a@!$ "@T aL "@O  !^@HH  !a@8p@-!r @99 ba @ "$"@0 "L"@+ ^ H"$ ba "@ "p @br "H R` R R` 2@  R`R  2@    㿠  @4` , @/` `@&`` n@2O`@+2 30?@ @ ,"O``@  ,"O `2O `@ `@@ʒ ,` O 㿠`` @@| ` @@@@ `@l`@ ה  X @   㿠  @0   @@  `@` ` "@ J`2@a2O`  ]  @  '  @`' ` 2O' & 㿠`@`&`@  2O 㿠`@` &`@ 2O ` @ `"@  ` @ 2O   2O  (㿠  @   @   `2O / &`,&` ` @t2H&`d` n` &`  `&`V $6`V &6`V (6`V *6` &` &`  @4?`  `,`$7`  @  `p@`L"H ` S 4 `$  S 4 `$`&`  2O @:$4$ 2O   `@ ` `-4``@ ` ``,  2``2O`    `/`@4`@ e ,%  ,@ %"@ 9` `@9 @S@ @Q@ @K # &HS`: :*` &H "HS` @@ S`Q @@ @2@  `@$@   `#` `#`! !   (OS``@ S`R @ 2@  ` $@  ``  " "  #`#` (OS``@ O@ 㿠&   㿠.`.&-`- (2@"  . $" . @ " #" *@ " @ " " `" " @?`@/ $ *`" 8#@  9 @ :` 0p?2? @ "@   @) `@# j"" "O" @" $O" "   @ "   &O"  *" 1@   +`1@   ) 0`  " @ @f "  2  9`"@   !(``" *` "@M! $ @  8`+ @"@ @  @k`h``000O0@-`0`4O`%0@``ji`1``11O11``@  `0`6O`0  "  $@    "@ 4O `$@     4@ @ $@   `6O  㿠 "@ @@  @  @@ؔ@ &   e& @ & :   ՞ȶ&6=@` @cܘ$@"q,, ``@3` @@`@F@`` OA,`@ eO`  & @ &  㿠@@&@n@  e & 2@d  &  @& * \  `2@Q $H'/ H&  J  `@ .` 7   @ / 7` Nx@s@n@@g -5`Oߐ: :`" 2?㿠 ;@`x@   J xG y@B X? Y@@ρ  ݖ .p002p0hP88d@֬&5` @},=`,@`@A@X @ A? @P @ $A$ $#<`@w )$#<&@@@6@  O``>,@^ e@?` ∔8@H .`@  B` u e @9 `u*O`ܸ ܮ ` *O`v x  *O` u 8 @  ܢܨ ` *O` {``u*O`   @ p 耦`    _ \ ۀ`    X  T ̀`   @ø vvx B *O` ? ٖ @ ƺƠ `, *O` 66``?*O`   @ 0 9 a  f A  F`   @x   *O `*O`a`!d  @X ʮʴ א *O JJǐ `!d*O`A`!a d @8  ` *O` `aa*O!` ~!D @ PPR*O ` `~*O `@ e & @ & , e & `@  & 㿠.p06200* .`7`7 ]* .55@@    P   F@A*@S㿠(@  `"@ `@2@  `2O  ~(@Ა@? ׀ 2@۰  @!  ?Ƞ$ $ `@2@` `)"@\ @b!?Р$ `@! ?Ԡ$ `  @+!?( `a!?̂` "@ !?ؠ$ .` @$ $ `$?$ $ `8(@!> A(! ?ؠ? @!?$ !?`@N`<1!@"@m !?(@"@f !?$  ?Р$ ``@! ?Ԡ$ .$ @$ $ $ $ t !?``@E`<!?؀ @@ @!@?Ԡ @,@j@ !!?(@"@!^!? @!>!? @ !?I  㿈  (  N 5 2?@  `@#\'  @  @ `"@ b@ "@    #5 ?`&    " 1 8 `   " 7 :`$  @  @'@Ŗ `@@9 `@#\ @  `@n@`"H'`@ (O @ `@T`@`"H'`@(O @  & 4<$   '@ 1`@9   `@@   %2 ? %`     !08`#`   $4`@< "  `@ @  @ 㿘  ('`@8 `@b0@+ @@ @/@@ `"@ `@"@     2  9`     $4`@< "   &5=& 㿘  `M'`@D #\@ @@@/'#\ @ܚ  @`"H'"@` @  @ @@R@I@C#\@O֖  *O#\a#\@ @T@@M' @ @"H'"@9` @F   @  @@@ @$ݘ'`  @%&  (@  &@08`&  $6`@ =% '` @(O   *O#\'` `@8`@& 3`@!+`?`@jpjt"" "$`"""""O" `@"""`6O"*?`"`@ "`+` @`#  # O*㿠@? $W`,$@O` (2@ ` ` .&@` -@% ` `"@```@`2O $` @ @)`  "0; #@  "1  8`# 㿠N``b@ `(@`.@`=@  `b"@ `|H  @@ Ȗ` N`㿠` I  @A (  <@ @ `0 < @ @C#\@ @F@Ƙ @o@@f`#\@r @U@ O@Y `< @Q @`+ b0<@B H@ϐ @ H @@ @{ @$@@'`@q @ @i O@@@ @@ @@` 8"@`0㿠@# (`  <@ߖ `@@, @ @c``2O`  @[`  㿠N``b@ `(@`.H`="@   `b@ `|H @@=@` @㿠` L` @`@ <@  @`  <@{  "@V`@  $/``@@ @ '@ @@1 V` $8(`' ` -` "`` @@ @`{H  @Ȑ@Ɛ @*@@!'`@~ @'@V`5 $=`, " ` `` @@ @@ @@㿠`   <@  @ ` <@  "@V`@x  $/`@ @#\@ @ '@ @a@_0V` $8+`%` -  ` !`@@ @`H  @6@4 @,@@#`#\@ @'@V`5` $@= + " ` `` @@ @ @ @@㿠` /`2@V`  $(`@d   V` V`@!`7` 20?&3 :@/  &@- +``@ )@@ @ Ga"O = =?`"@ " 2?20?  44` 10? 0?@a= ?`5# = 3p?"2?`1p? @` 1 6 0? 3? 㿠"@E  $  V`*`@`4`@$`  `<@ܖ  `@-@) @ @`V` $," ``@WV` $-`$`  @ V` $/ %``2O $ 㿠 @`,`,@ 2H'  2@  `( 2@PP <` ` /` , Q@ @ @% `@$@B`9   * `(P@*@ @ `@@*" *O`# @ `;  (`+`U@* @ `@@" @*O` @@ @ @ '  `( 4 2?,`R`@^@ `"@' !``0@` "@  @@:@  6O"@ & 㿠 \@ @`,`,@ǔ2H$ 2@  `(2@S`S`` 9  *`@ (U@ 2@$   `@)@N`=    ) +P@ * @ `@"@  % `@@@3`@*O`.`@'`;` ` (@+ T *@ @ `@"@X  %  @@@ `@*O`` @G`@@H'` `@@(@ $`@@5"H   @2@- 2@*   `(5 2?`- R`@z@``@"@  $`"@   "@  $  `4`"H ` @```"@` ` @ *H ` ? 6O`㿠`,` @9`@5@`'``R@7` @- `0@*@ @# @@  `3   *@  `+`` @R0 3?2  @30? @V2O`` O4 `O H` ``@`````@`2@  `@7(`@@2 ` 4O`@)@q``@`  @ &`@ ` "`&O`&  @ @&`&@`-\$  @&@%`& 6}`! =&-)  <-``2@   2@  &  ՘ ` @6 2p?6 2?㿐@9>a@#@  #h#l@  `@#dSd`(( `@ ``#d#@2OSd& ` `@N    @ "@B  2@ R 2@   @@"  " - #`` @#d@Sd2H`@`d#h#l`-#`` @#d@SdG2O` hSl@@*! ` $  #` &O  `@ `0 @@@`&`0 `@ `4 @@ @@&`4``@2`(8``; `J("` "#`(#` 83`` ` ; J #`` `$9`J  #`` @Z `  "``" ` @&O` (UU9 ~K@ 0 " 9 08`#@ 8`@`) "(`8 @ ` @ :H` ``@` ` @*O` "`8 @`@ :H` ``"@` ` @ *O` "`8  @ " ` @ `H@9$a#@ e@@ @`@b@` ` `6O`A?,@ @Q`: f2@`@t ``@  @ ` ` O  @` 'A0@1@ @ @@ `  `O@`@ @@ @ @@U&@.@0@,@@@ǖa8"  s؞㿠@;@ba8@sɒ > " " " " p" %`2@&&%&  " ` @ "` 3㿠@;@aa8@s  `@'`  '` @` `@`2@%```2O` '` `` ``2O`'` 㿠@;@a a8@s_  `@@@  `@' ' S`@ @2O '` "H' =㿠@;@`Da8@s-  @ƴc@@`@ @9%   @"@% a<`0,  `@ ;%`@ " ` 2O % 'p@'p'''@ @0@M"@?А`@!LP @ @_L#a&L ,&`@ 6@ @@/ &@"H @& ?㿠@;%b`@@@ 1@-%!<†@@% @ 'a``@@@;A8;@  ` @`@`@`"H(` `@`"H`  ` @`@H`H# %A;@) `` X@*` (@ #a@ @`M  %= H@D 4@'LLP`@(@L_L&L *L&L.`@C 6@ @@ &@ '& 4 P@4^L 4&L ,4L &L* L`&L)`L &L) L&L*`@ @ @) &@  @&  ` -`@ y @ؖ  `#= aL@ϖ `4@'LLP`@ (@L^L&L *L&L. @C @ @ & @ #& 4 P`@ ^L4` &L,4`L4` &L* L&L*L &L) L&L(@ @ @/ &@ %&  `5 ` T&@4`)  W@*` `)`@ @` -`@  $`$`@!<@  ,@@@!$@ x$ %.@ %/  @C`@ `(@ y@` `) @LP@ @%]L@ &L / +`# ,@ @  @ @@ &"H @&  &` @ & @"@ @H A?p@ 9 `.@   `**@ @@/LP2@L]L@&L : :, ;, ;a+`@ (@Y @ @@ &"H @& K @P` PL + @@ ][L@&L 5 5, 6, 6a+`@ (@# @ @@ & "H &  @ @  @@ &` . @@@X h@#\ 6#` @k ` !!*] = aP @;   @%LP @ @L\ݐL&L+L&L( `HD 6@  @@&"H$@ & 5LP`@ @L\L 5`&L *`5L &L) 5L&L(L`&L(`L&L*  H @ @@&"H$@@& ] HL  ^@lA&  @$LP@ (@`\n``&`+```&`(` @A 6@ @&"H$@& 4LLP`(@`\L` &` ) 4` 4&`(4``&`(``&`*` &`*   @ @ @ @&"H$@@& LH%# ]@ A?8[& LP2@`\`&` ( H`@ @ @@&"H & `@А\ \ p2@P` PL+  @ @ )[ِ` )`&`,`\ǒ\ T2@4` L`, P@ ([``&` (,` !-!@,@ @  @ @@&"H & HАLԖ'@" ]' `& 㿀@¸  b @ @ `\r -&`@s  `(@!LP@ @[cL&L *& @ @ @@; &"H @& \> & LH&`Ȕ%@@=  ``+ @" LP2@L[-L`&L! @*`&`@ @ @' &@"H & HL%%@\ @`$@\ & & 㿠@`L` c@@2@ 5=7=]Xpm  ``@s/ᨐ?  @'LP@(@LZǐL`&L *`L &L) `@F 6@ @@@ & @ $@& 7 LP`(@LZL&L ,5 L 5 `&L*`5 L&L(L&L-L&L+`@ @ @ @- &@@ %@&    `)`@@ *`   `-` H[ @L@` ` *@ O"@ `^;@]N|0jB? 6@< LP`@/Z6L ?᨞ &L) L`&L`.``"@_'  @ @ @ &@ @@` @& ' ^]1@< j? @5  @&H&LP@(@LYL`&L >)`La&L`(% `@6@ @@ &@ @ `"& `%& ' ^o\Ր9@ `@ Q  ' ' 4' 0 ' 0' ' 4  %@ 0Ƙ "@&    #  @`@#   @ &@ /P  .`!@@  -``@  `'   # '` '` '` '` h O @{@l p"H]  `,\}   "  "e@&"H%d  O&@  @2@ .  .` "    & & &   '  @!`e!` vDvK`Lŀ` w*`@ @4  @5@ h@ @2@ .Đ  /`  ! ! ! !  ' @"@ @!@  @ @"H @%@ O   @   #@%  %@% @Ґ"@ ' 0 ;@}ĺ @@ @ @ > @@ >@@w@ d @o!@ > @g%@ @_9%)@!P,`>̺ @@<P@O@@"@ @ 9@= @7@g 2H<,|l \LlL,p㾠  `,& `(@&b@*˔@̢@L` @`*@2OL`'`0'`0L` +@b -@` %@@!Zܒ `" '~@&!@ '`  & @& & & '`0 @:@5@" tt@;`u@"`@;` `@ @  `#h#lhl'`  & $& 4H& @& '`0 ` & & & '`0L`@ ?&! D]@-@ &   &   &   &   &   &   &   &   &   &   &   &   &   &    &  `@L`<@="H   `&  &  &  &  `& &  '`0   & #@L``>@`="H   `&  &  &  &  `& &  '`0  & L` =@   @ @ &  `& &  '`0  & L`=@  "@`@ &  `& &  '`0  & L`&@  %@@ &  `& &  '`0  &   & L`|@   `@ &  `& &  '`0  !&  L` q@  "@`@ & ` "& & '`0 L`e@ $ @  #& ` & & '`0  &@e  @e! O@-eO @@.@ &  @ _2@  @%eg@d O@- dO G瀢_"O@ & $@& '`0  &  '`0&  &  㿘@`b@@ N `02@ N N x@X@ `/ ` 2H9'@ )"@+  `"@&'@N !   `@ .9 @`O` O ."@  e"@  E"@ '@'@ @J!`+@? M⠈@ + @@ *OJ"㿠````@/ +``!@, @` @ '`$ $ $ `$ $ $@$ $ $ 8@  c@'@ <@ #@~@۔  )@? @Ւ OQ , /> M,X\Θ  &`   & 0㿠@  & "@ @}  `@`J`N`2@`@@``2O`%`%`%`  @ '`@Ւ'`'`'`  '`& 㿠 `@`J`N`2@`@{@``2O` `&`&` &  㿠 `@ `J`N`2@`@[@````2O``@` "@` `& `"@`@  `' 8`6  㿐 ܐ `& _@  b2O   " `" ܆ " " "  "` "``"``䀡 @ `耠@` 0? 㿠6 ?`@@:$@:#+ @ `6 ?c) &`@ `&``&@2`c' @q:'@R @ 2`2` 0&/ $, @ )! c``0`!X&``@```  ` @@?ن` ?ۖ@?ܺ ?ݢ@ ?ު@ @?߄@?? ??@ ?@??? ? ??@ @?? ?@@ ??@ ??@? ?@?@@?@@?@???@@?@ ? ?@  ?? @@?@       @  @@ ?@ ??  ???  ?@@?? ??@? ?@???@?? ?  @?@?@?@??  ??@ r R " r R "   & `6 "`9``&``@` `@` `@ `` ` ` `  ` @`@ @ `@ `@:`<`` `@ ` `` `? ` `@@ `@ `  ` `  ` @@ `  ` @ ` @   ` @@@@`6`&`@ ` `` @2`7 qR @ 2` 2` # +` '@R @ 2`2` "-`@$ , @  㿠; `q%?R @ 2`2`%-@&@5 R @ R @ 2`2` 6`"6  ) @@%%@&8&@8$@@8$@,` :c  ` #\ \``@ @C㿠8> ``:c ,4 *``2` ;   & 2` ` 2` ? +  2`  #@ @  1   1  * c1  @c@ @7``7` ?) @7`@ @ 7``7`. c7` @@7``7` . #7` c@@7``7` . #7` c@@2 2+`2@ @@@4  4  4  #+ @@@ :v :O R-; -6`(&= & 3` `3` #3` ?* c @`@6  &4  4  c4  *@ @@: 2<  6` %:`3:c` *@4 2`<  &4  `, @  *`7  -@7 <  㿠6 ?6 . @.7<`%>0`(`- @)0` &3@ c@ & 7`` 7`  , #@7`  #@@    7`` 7` *  c@7`  @@ 7``7` ?* @7` #@ 7``7` . #7`@c@  7``7` ?- c@7`c@7``7` +` #@7`@  7``7` +` #@7`@  5 5c5 #.` @ :v :P  S/@.6 )'8 &   ?@`@000/`@@` @ 6`   &@0``0`0` @+ @ :  288`6`1> >c0`@+ (`2  8`0`#(`+`7 *`/ 7 @-/ 8`1  1 ) (@㾠 +;n  c ' '  ' ''`.  '`.  '`. `'.     6  ` `6 %``$    0  0 "`  ` `  3`` ` 3`$ ` $`  6 6 >`/ `  7``   7` ``$`  6  6>  8ҲѶ @s t2"  " ? &   && &$&(&8&<&@&D&H&d&h&l&L&P@&X@S &T@b.\ N`? r wrw.\N`wa0.\N`09fh R  2( (N``2N`N\  w@i !n 8!#\ #`? @@& `&H )@O @& 8?&D%n@!ݔ;D7)+&%#@6 @ &@@( N\w1n#\ !#p  #` 5B#d #h#l@2&`@u@@"&`@ @  ?'p;n @_aԔЁ 㿠N \w ` 9 @  H@& & ?& 8@ ?㿠 <`" ? ) @  D@%#   @& < & ` "??& 8? D&  " & &  㿠 #3  D `,5 D >@& @@  @` ` ?& 8 D& & & X  gB @ b & $&  S Q `` * ? $%`? x r  i `c   Y`` <`" & 8?& 8 ?& 8  & X 㿠2 P? " @ `  @N \wr@ %  @  @@) @  @;c2? 8 D `" H@x H " T@r T @l@j㿠;?N \r7? 8"3?"0?` & &  L l?).`?   h p & l& h& &  & 8 `) X' ?  ` <  @ D@u$ &  @& <` " D ?& 8 L D&   d  h & d @ & h   & 8 h d & h @C& d  L&@& Lz wt* -n@*  L?@ & 8@!ca_]?"& 8 8 @i    8& L  ~ L& 8 z L <`  2 X k L h L e L @ ` @ I   8 ` `. ``.6 `& `.# `&` ``&6` ` . `. `. @  @@ & '& '@& &   @@ &&  d  h@& d& h& <  Lb$ & L2 & 8"?2&? 㿘 ? " "?J`\r?"?`l?2?`8`h"`l` ?"`h`?"`p""`<"`8"`<?㿠)'"  N`` ` x O  ` / @2  `/ `  㿠?N \w;& /& ;    H @@& &   d?& 8 L d h & d@& h  & 8 h d%@& h$& d`ـ  L & L& ?'LL'P'T'X@/?o H``  㿘C/N \`w>  9&  &   H @@& &   d?& 8 L d h@ & d@l& h  & 8 h d%@& h$& d ـ L M &`& L ?㿠@ԐQ 㿠S?N \`wN & !  @ @V H  H& 7&  h@@'& h & 8 h'& h?& 8? # h@& h ? h% & h& 8   `? & 8 @ À ¢  8  ? 㿠 @  @ 8 "  㿠Ӏ"Ҳ? 8̀"̲?N \ wh` d&@`6 D?`` 9@~& D?` @N`$ dN \?9@`w?<@  D & -&    H @@& &   d& 8 L d h & d@& h  & 8 h d%& h#@& dڀ Lb & L"h?@ 4N \ d`` h@`6 X?` ? D & &  @@|& l6& d?`& h` h@&@ `@@`?`. H 5@& H?` l ? h p& l & h & 8`@u H$ ?@@ h` h`?`㿠N \r? D  & 8 & & & <& l& L X` @U&d&h @`@ ?㿠z? 8?u?t?N \`w2 h D2l d3@& D?` @W d``6 X?` ? D & &  @@& l6& d?`& h` h@&@ ``?`. H  ;@J& H?` l ? h p& l& h & 8`@ H$ ?@@ h` h`?`J \r  < " 8 ` `? J \`r X 㿠 @]`6``` 㿠2N \?`w Ґ" @)  L @  d@: 7  㿠E"?&`  8&`!n!܀#@?c P  P" 8N ` 8-/E`%@@W T@T@@& P9E# @ T P;n@ba P@_ P   @ 8 ` " 8" <* @8㿠\`"?J``1`8 2 ? & & (%X&  $%|& $   ? ? ?`8u?2r?`8n? 8k?`8h?3 (  b2& ?" 0  " -@*" -@%$`4""$`L b$`P$`$`,$`TR @  2`  (@$`X$`8   (ƀ`,$`@   (ŀ`L$`D  -@  ($@`8$`@, $` `@`%E`D #$`bb ?$@ $@$`,`$@ %E"$`@M& ?? 㿠   2   *y ` 0k& 0: , % 8&@ 8` @ `.  ``.  6 `& `. # 8`& `  ``&  6` ` .  `.  `.  8@ 8' \&' l`  T' H  X.@ ' H  4.  @ D`@ *@ ' H.@17@`@. ?㿠6 `2 . $* & , q& ``'`>'`& & '`` *'`   . '`( & 0 ǐ '`(& 0@F@$ ?    `"# ? ?    +@ "!  "1?㿠"=? `8`  82?8/?`.`)C,%@# 8,+`  2     @ʐ`"$`    $`$`$`|$`$`$` ?   ` #`|#`#`#`? `?0``0 @ @   2  0`?`23`@   `?2 `1  @ P  `?`3`3 ` @ @ @*ў 2` " *   " )㿠  ` @@R  8 `    `/  ``/  6 `& `/ # `' `  `` '  6`   ` /  `/  `/  @  & @&  %&  @& %% 㿠J? E`D? :E `2 2E`,E ?3Ec& (*&(& ؔ   Ð   `&& 0+  &+&* `2:&, &+&* `&( `&( &   .  . .  q &.&Ѐ & ``,` @ ``$        @@ /@ & - &4,@& 2) &0`. &   .  . .&` +  " , & /@ &5 -@,2 "  0& 0&  E&J&  I0# * ` `(  @2  ( ,`l%` R @ %@  q&0@`0`/ '@%@d$l   0]3  0?X*   T & 0E2V``M'?` @?@ 2 `,  $ 0& 0<  ` & @ (  & `* `,   $ 0n@& 0 `"&   &  I&  I& I2B `9 [ 2  , $ 0B& 0 $  ` & &(2  ,  $ 0!@& 0&  [& &[2A$ 8 g 2 ,` $ 0& 0 # $ & & (@2 , $ 0ޒ& 0 g& &g, ,`$  ( s    &  0   q( 0&0`.&& 0  q& " P 2?&( "2  `2)7Et2)t 2@ `E?& "2tt`2``"]` 27E?& (`C 8/ @" ` "&  ;` @o,  @<`%LD#`+  2 @    " "   *  *  2* ͐ ?&( `"   9 0`&( 0`&6- 0&5`, 0 &4 +@   &*@ &0/ `&5-@ `&5 , 0%?r5  0`&*4`+ `&* n` &`? `2  ?&( ?& ?㿠"B? ">?*EI [ gq?`"D $@ ( D`"@ $ ( @`"8 $ ( 8` $@ (  $@ (& q ?  㿠YW``S 8@! ( " @2& ?@Ԕ'`  `, ( '`8 ( @`,'`@  ( `L'`D " ( Ā@`8  '``@`D `,`8*` 8 `  `` `.  ``.  6 `& `. #`,`& `  ``&  6`` ` .  `.  `. `,@n`,`@.``@` 8 ` `` `.  ``.  6 `& `. #`L`& `  ``&  6`` ` .  `.  `. `L@/`L`D*`D 8 `     `- ``-6 `& `-#` `%` ``%6`  ` - `- `-` @` ` `8 `  `- ``-6 `& `-#``% ` `` %6`  ` - `- `-`@``""`j|i@ `'` / ?&@'@'@'k0'k'k$ _??㿠 L , D$`, +& < 2 @    " " "  *  *  2*  & H;C & ``8& x.& \'@& h.`& l& |& & & & t 㿠 8 l x  | @  ,5 t'a@ @ !  4@ @N K @  F @  @   .  (   "          @   @ *ш !!& p    @,@@` @㿠 %?'`` @ tB ,4$,  l < & 8 8  ` `/  ``/  6 `& `/ # L`' `  ``'  6` ` /  `/  `/  L@ L \+ l p#@ D#& \%@& l& p& 3     0  @  "0 6 @&" `@"    "2 "  t#%`  &3 # 6  t ` {`` @2`]- %` 8` ` `0%`0 ```v`0%`0` 8 `   `. ``.6 `& `.#``&` ``&6`  ` . `. `.`@А` t@`%`%` & t 8 l X  T& H* @.& H  `2 ,2' l`2 \  l ` 8`?@$@ l & \  ``       l \@& l@ :& l& tp ,& l$@ & t    8@ #@  l``` @S& \ ` 8 `    `/  ``/  6 `& `/ #` `' `  ``'  6`  ` /  `/  `/ ` @+` `$` &``#@$```$` `` `  `"  , \#! l%@ =    8@ w  l& \  2. t  㿠9  l"""" t!S  ,5%-  l  8  <8$ `   `* ``*6 `& `*# L`"` ``"6` ` * `* `* L@  L \+ l p  D @& \ & l& p& 3    @ "@0  @`@  "@0` `6` @&##   "3# "#`  `"6&6  t` !*`  }  < @` @ 2] * & 8 @ /0&0 0&0 8 `  `, ``,6 `& `,#`$ ` `` $6`  ` , `, `,@ߐ t&&  & t! 8 l X   T& H( @ .& H `2 ,`$  l$  \ `  8@`?@ ## l & \ ` `{   v       8 H X T,  D 4 @) & H *4 5f# ,%@a $%& ` lW `S`Q 8 @I  C  ` . `` @ ( `` @" ``  `` @ ``   ``  `` @*Ѫ`%@a   & `` & p  & ` & ` ` g-  pE`# $2*&4.+!䘪`5/D 5D4 `+   t鈀 `? $& t`$2鈀  !% l& ` 4 8 @ D H T X& l ,`& `+ @& H,@ 45@ 2& l. l 8& `& l   T& H  X) & H 8- &2,+ #` t l`?5 %`& t`& l! \   8@@ #  l``` S& \ ` 8 `    `, ``,6 `& `,#` `$ ` `` $6`   ` , `, `,` @E` `%` $``$%`@`%`%%  `2@ l  㿠5  l t'☀!h ,4$, ` l@  8 <8$ ` @ `+ ``+6 `' `+$ L`#` ``#6` ` + ` + `+ L@ L \* l p" D & \ @& l& p& 2    @ "@0  @   "2 " 6  @@&"` "`` @   @2`"` &# ?  `#6&6  t@` !*` ` } <" ` @2] *&@   8 `0&0 0&0 8 ` ` `-` ``-``6 `& `-`#`%` ` ``` %``6`  ` -` `-` `-`@@&& t  & t! 8 l X ` T& H( @ C& H `2 ,`9  l29 `` h`  8%` +``&(0 .  & h 2  l \ 8@`?@ ?%@ l & \  ``        ` p  ` 8 H  X T-  D  4  @.& H @) 4 5& d & x  & `   & `  ,%@!!  & `  $  & `*& ` x l[ g & ` l 8  @I `Ca`  .   (   "     @        *Ѯ%   & `& p` & ` & `` `  p%@ 8    & `  & `  u@s$E d `%`%`  &) #@ # t-`4 ,($2`!`5$D 2`Dc@ -"  t i   x l"@& t%`?& x`5)@ 8`& l  H T D 4 @ @)  X, & H.0@ 2& x2`& h & ``& l! \ `  8@ %@ l & \ ``2o l  h%` 8 +&*0@- l @j6 \ `  8 @ޔ%   l``  U& \`  8 `   `. ``.6 `& `.# `&`` ```&6``  ` . `. `. @" % @$&%$ l@%$ t "& l& t`怣!   t` & h& l$& tڀ!㿠"{?N1v8t 2 ? & & (7%X&  $`-%|& $`   (( (? #b"S?&  "  '`,  '` b'`0'`4'`L'`P'`T'`X'`  ( '`8  (`,'`@   (`L'`D '@ @ (@`8'`.'` `@ 'E`D '`"@b'`'@b '@/`$ 'E"'`@& ?? Ԇa 8  " ?؂? |" $" , 00 2` `!200錘"0000000000000000000000000000""0ꨈ" 00|0000000000000000   0䔝㿠6+<;6+>`T`6+Z-``6+@=+\6+X6+B,6+D@6+F6+H6+J6+L6+N6+P6+R6+T6+V3  ``  2 . /+\ @-`*`@ @ 6`(`k<`5k<@%-@ R @ @&<$? .+\  -`(`@(@` @ $5*@< 5<@  @*@R @ @@&@R @  & `<$` s.-+<k<@ % `?" `" ,<>! ?0<`0><"4<4k<L<`C``%..+\"``"`"`* " @ & Z @: @ 4@&.+\@$``+ @ @&Z @: @ 5 &`$`%2 㿀`+"=``P`T  ?&&`X   ``&* ,#k\4  @$ `?!bb `X`&` .`+ 4#k\! `*" ``&&&`b `X`&`+   ` "\(%+@0@``&&`3`@: H.+\`X ? 6,-@@ k\(@ k`+` &  @ @  + k\(  @ ** #\+  ԓ**'k\%6.`X+`+`& \ 6&+`-@@   k\+ @k`(`@& @@ @  * +\+  @@$ ) )  #k\* ԑ) ) "\( +` &. *"k\ ?&-` @ 5`"+\@`&+`!  33 ,+`6  -@ +\*@+`+`@& @ @  * k\*@ @$ ((  #\* ԃ(( \`6\+`+`+<&/`$\"=  " `&+<` +>`*4*7,2`,`6 + 3`+ `6 , 1 `,6 -`6 +< `(7(7` (5(`-   $+    24  (?2 @.`?2 @ -   4 @.`?  3`7  $  㿠`.;?c@    E7  ?`  @"5 @,@|0|` ,@| 2|*`6* `` 4**6*`6*Ā`             Â` 㿠`    9 ""?` @"u \ --`@~$@ @ "|  ) `&  6*   & : .@$@&9 6 |, @ &62~3-`@~$@ @ |"  ) `&  6*   & ;/@$@ &9 6 |* @ &66~`q@'-`j~$@@j|'   (  & 6/@  & 9 + $@@&86 *j|* @&6*$@ @ # *  ( & 6+    & : /@$@86 *@ + 6 +&6 & +0 +@   `& :*@$@?&86 &.6 4K**$@ @"`* ) ` & 6*   & 8.@$@ @9 6 *@  + 6 + &6 & +3` /@    & :*@$@&?6Q&. 6I$@ "`* )  & 6,  & ? /@$@ @9 6 *Ĕ  +@6 + &6& +1  +@  `& :*@$@?&?6 &. 6     @        㿠+b b~  * * `& 65 *  `& ;( % ?< 6 b~ (   6  .b&@ 6 & . 2` ,   & :/@$; .@  * b& 6 & * 2 ,@  & 8-%?&=6 b/ &6 0;C aab  -   ~ & . @6+  & :`) &>6   ~- &@6$ ʒ )ǁ 㿠)'P"` ."   & R 6 ,  & :`) &=6@ `&". @6@ 㿠;3Dbb    b -& @6 *   & ;`/ %@ =6 %@b-6%@b b&&-  &  6 *@   & 8`.%@  =`- `b 6`b&    .  & ; ,@&6; `0b b & `6& +$ ` :` &- @6& & *@   & ;`/ %@ =&6Vb&b b$6 ` 6Kb-`@ - b &6& &)   & 8`.%@  =6-4-b6    b & *  8`& .&6b& b `& - = 6 ?&b & 㿠 !  )   ,`@b+ ^+$+-?5))+((`   `  `E0 ?)  @"5 -`*| 3*|` @ -`*|6*|*`7* 4**7*`7*Ā    @      Ô%C+0  -*~ ? 6 "("! '` 53`` @  `Dr  ?@ =" #" ` +@  ' +` 0 7*@  ' >`.++(%@?'<7  +"`.@ +( '7``@1 "DC b" `, `' ,5 7.  ' 9 * @'< 7"`* '7@ 4``47)7)"7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)7)""7*" 7*`7*|7*7*7*7*7*7*7*7*7*7*7*7*7*7*7*7*''''7$ @  "" " (" 3 +@*" `0`" +@ E"``"  *`"  `0  D""  `+` 0Da"+` +`@ 3)`?㿠%9C!E-D  )D (` `+`+  `# $@ @ "  *`& 6(    & 8*@ "@ &:6+ & 6 (`( #@ #@   *& 6*  & ; * # :@ .+ ! # + &"`6 & +2 (  `& ;*  " 96 #"`)  66"`0+@ CaC+`@ !,@& #  &+ & 6 *   & 9 * " ;  )  -E p#@   (& 6& (0 .     & :`(& &;6 +& 6&6@ *d '@d&   , & 6(@   & : + '@ &<6d& d&,6d&    `  &      &  `?# , # ,b b   "  ` (   " 8+ " b    " (" b2 㿠ܐ9 "& .> 4`& + ,` 3  `& *   & )  `& . & `& N`% ` -2  nbl UE* b" 㿠R @ @^  @] ` "`e0 "  """0"`<"` "`"`"` "`"`("`,"`0"`8"`L"`P"`l?"? `4?< 8?  < +@  *@8 8?㿠ZNK"؀ U8S 2 ?& # & (!%"X&  $ )%"|& $ (a0`?&  "  >``0&" ``8" $" 4  " $?'  %0& 5  & 0& & ' l' L' P' ' ' ' ' ' (' ,' 0' 8' <` $@ (& ??㿠J%N`L؀E8C ?  & + & ()%"X&  $ 3%b|& $ (a0? &   " 4 " $ " ? ' %03 & & 0& &  ' l' L' P' ' ' ' ' ' (' ,' 0' 8' < ? |l  < $(8 ""@?  ? ? #\ 2? #쀢 c %      X T ?#d̬ #h #l'%0/޺ p/߬"' l'''#` 8 <]&bp*@  ` %  ` $.@`` `"#    ߒ % / /   %  % ʀ % l! 0 `? 4* @ R @ &@ 2@3`(#@-   &  %   4 $ `   %`&  %    -@ %  c %  & 0  %     & % |` $*``  %   #(&  % b`8 cD&  %  W 4 #  b  /4/ x %  %  `  M$*@``   2!   4/4/4 //R %  %   ` &$(@``  ` &`4 "    /4 /*  % +  %  #` $(``  `% @%`   /4/  %    2  %  $"g% @ @@` @]` L H  #@ 8"@ 8    `+ ``+6 `' `+$ `#` ``#6`  ` + ` + `+ @5 "$ ז%  @ @% @`n% @ %  2e  @ `    @ % @ *@" @*  "$ f% C& b$ [% % @ `2#`% @ % 3 @2)  @`$   @(% @$+" @*  b$ *% & "$ %   2 $ %  "` $*``  ?*  c`&  %  Ā   ` 9  `&`, # 0  %  & 0%  `  $*``  ? 44 @ @(` ,@ %  & 0%     \ %  & 0%  \&  & & & % <% 8\     `%  4 %@ j` x$+@`` 4 ` %  " +4""%44 %  %`B% 4GE#% P % X% L  % T%`24 % %` +`4t&  %  %`" `%@` 4-$*``  4?   3c&  %  `% @  %   @`a@` @` ` I ` `+  ``+  6 `7 `$@$+   @ % @̀``# ``  ```#  6``` `+  `+ $@ `$+   @#@% @@n $@ @$"@% @ %   ` $(`` 4 4 4 % ` % \a% d %`` % % h  \ &  % i` \ h  G㐀` q$+@`` +  % h %`4+ 1 p \ h 急` G+ @  % h+`@2p h  + % L % T % lh@  #` &  % !  `  d% h %     d ` h   T( L#` .` `77$*@` +`@77% h%@(6`p4 d ` hu &@ $*`@ 4 %@ +` 4@p`%`;  & %  @ $*@`@ 4%@6``"`  @  $*@`@  4%@0`` %` R`"`% h( 6`p h " "% h(6`p h ` d *[ T "c  % T% L% lh@!  #`  &  % O` l  `% P % X(`d d@  #`  <&  % 7` %   `&  % +  a & & & & % <@% 8      < 8 T  L( ` (  `77$*` .` @ 77:2377 ( ` 2@.` @ 77@$.@` 3* @ `77@쀤4%@% @4%@4%@% @  % `  %  `@  T&  %   `% H %  H`@  $)`@    @%@ * ` 4 % @ %   X P("` (  `77y$*` +` 77077("` 6@@+   77@L$+` 2(` @ `77쀤4%@4 @ %@ 3 `p&  %   % H% % D H@ $*`@   D%@*@#` 4% D , D#@ &  %  耡  % `$ D# 0   @  (  4` "@ @ @ #@ 4` @  @ @& ` @" % @`$@ & 3`&: `# & @ `  `.2 ) @  & @! @`   @` `*`` *` * `*``6 ` @2x  %  t `  @ $`.% i J`  t$)``   @ &  @ %   & } %  % & 0  4? 4, @* @  & % (  `. + %  %  "  `  "$(@``     &  %      %  #`& ?#`& & & &  (% 8 % <  ` "  4 $  .@ ($4 % ?(` $$,$0($( $@ C`   8 @  ``` `, ``,6 `& `,#(`$` ``$6`` ` , `, `,(@L($,$0 0 #@@#`  8 `   `- ``-6 `& `-#@`%`` ```%6`` ` - `- `-@@@D`  48$ ` `` `- ``-6 `& `-#(`%`` ```%6``` ` - `- `-(@Ð($,$0 0(,@2$0$0@@$,  $    @@& &   @%     #% & 0  Ι%@% & 0    @ <  @ @& ,\2`` 2 `???㿠   $` 4`" (@ (  $ (@&  ?㿠   "   ? 2   7 4  " ?`4  `$  ,@ ('`4 ' ?`( `$'`,'`0,'`( % C  8& `  `. ``.6 `& `.#`(`&`` ```&6`` ` . `. `.`(@~Ȑ`('`,'`0 (`0 $%` @ 8 ` `. ``.6 `& `.#`&` ``&6` ` . `. `.@~D  `48! `    `.  ``.  6 `& `. #`(`& `  ``&  6`  ` .  `.  `. `(@~?`('`,'`0 (`0`(`, 2'`0'`0 '`, ( C@ 4 $ 8 `@   `. ``.6 `& `.# (`& ` `` &6`   ` . `. `. (@} (' ,C   4@ 8#@` @ `- ``-6 `& `-#' ,`%` ``%6` ` - `- `-' ,@}' , '  ?    ` ?# "`0?  ? 2   <`?h ;  < 8! (! 8# -! <+d d < 8 `! <3`! 8:* ! h   * @`    #@   * ! h! h ! h  h `  `* @``     `* ! h    @ " @ " "  h2#?   " 0"  " " " 0"""" " "(","0"8"<"L"P"l" "  ! h?h"?   ? `   < `?㿠Ʋ`` `$% `( 024?. 8@| @|0L0 ,'<    %0&LP"8  %0&Pl&>` @ e0&lv&4$  ` -@`(p 8@|w@|s0L0 , #:` @ ?0&LP @? ` 0&Pl $$;    e0&l(4 8 `  `.  ``.  6 `& `. #&4`& `  ``&  6` ` .  `.  `. &4@|&4 & `$`(??877…7777777777777#\27$@ `"   `@/ @4@ / `@@4@$  -  (`2 -  (@ ! (\    @ /ܰ /ݲ&00&2\2'  \      /    @,  ) @` 䂧` @'7 "?2|?@7` 䨧` @'7Ɣ 7 7 5   5 ?5515+c@ " % ` `+ *53@$`  -@`*`+``61 ,  " H+H#d #h#l %G $!#l%#d"#h  'H`b#h#d?#l  +/    +: + /  ' %#`+#p?  `lp //75 +dh/755 `/7ܚ @ ޴@ .6 3@ ܴ@ .632܀ 3`@3`@23``I  ) #` @#+3  2 W2 `F-  @/ܲ `7޺ /@ `  /ݦ  ܹ5ޑ/ @2 3 3`@3`@23``#` @  ڀ[ ) %+ 3`@2  K 2 `- @ / ' +'#p+c` _*' #p,@ *+ *` +    +  * +  %@+; + `;`3*`\- &&` ? 㿈    0 T& X5        .?. ,$` 4  (@&@ <%"!#h%#\ `#`&  #d$`#l 8 L P  ` ``*.  . `3p q p5   # @ * " *3p p q 5  -  ' & ! ' !& &   ``*  + " 5  ` ``+*  + `3p3r q p5 ` `@r .@ " + @3p3r p q`5 `@ r  '  & & r `  ``* ``*  l*@ & "`  @`5h"@ T R$ 1 `& & `2% ; `#  & @ `"   -2 &   & #@ @  @   +`` ?+` + +` `6 & 倦 "`# ܚ `& & `3 % :`"  & @ `  -2 , ? & #@ @  @  ?? +` ` +`  + +`? `6  &5`% : # d @ '&@\   `?` -` -` - -`6 & ]` `-`& Q% L `& & `2% ; `#  & @ `"   -2 ,&   & #@   @     * ?* * * 6 &  `-& ``- `-8 `4 `-/ `-*@) '  & =& & `-& ``- `-8 `` -  -@-@ †& 0 %@ - @$a& #`& ' < `& ' 8 & 0%@   @-@ $!&  &  ' <& ' 8 h';n'̔bt 8'Ԓ`'''A' `ِȀ  &Ȁ` ?`ܐ&``h';n'̔bt 8'Ԓ?`'''' `ձȀ  Ȁ` ?`ܐ&``2 2 `   㿠 㿠 "wb #0 #8 # $ $ % % % % %, %4 % % % % % % % & & & & & & & & & ' ' ' ' ' ' ' ' ,8 ,@ ,H ,T ,\ ,h($6Q)5%*:&8! =2PL3KJIHGFE410/-'>N.ODA<CB7,? #+9;M "@@gigigigigigigigigigigigigi ,gigigigigigigigigigigi gigigigi gigigigigigigigigigigigigigigigi gigi0FEDBA@?><;:97       gi   -+ :/-   ,       ,.-:/--:        -:   5!*01/234  ,'#-)6"%$.+ 7(6& @@w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz taf deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly K S8 S8 S8 ^l ^l ^l  ^l  ^l  ^l1.2.3       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`   , @ P h`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@-archive-compressedsize-method-mount-offset-uncompressedsizecrapvfs/%s/%sfailed to initialize crapvfsarchive not mounted by crapvfsr-translationbinaryoffsetheadersCRAPbad end of central directory recordFILECRAPFILEbad central file recordboot.tcl1.2.3CRAP/r-translationbinary1.2.3crapvfs%x%xstale file handlenonezliblzmaunknown-infoarray?options? ?crapFile? ?mountPoint?optionmountPointpasswordcrapvfs1.0crapvfs::setPasswordcrapvfs::mountcrapvfs::unmount*vfs*-delete-level?options? filename ?gzFilename?option%d?options? filename ?gzFilename?.gzr-translationbinaryerror writing compressed dataerror closing compressed file-delete?options? gzFilename ?filename?option?options? gzFilename ?filename?*.gzrbw-translationbinaryerror reading from fileerror writing output dataerror closing compressed file%0*lofailed to store integer value: octal too long-buffersize-gid-gname-mtime-name-permissions-uid-unameminiarcHandle nativeHandle fileName ?options?optionfilename too longustar /bad file typer-translationbinary-buffersize-corefile-level-method-mtime-name-password-tempminiarcHandle nativeHandle fileName ?options?optioninvalid level: must be between 1 and 9r-translationbinary1.2.3headersheadersnitems-buffersize-corefile-level-method-mtime-name-password-tempminiarcHandle nativeHandle fileName ?options?optionfilename too longFILE00%ld%lu%luCEr-translationbinary%lldheaders-buffersize-corefile-level-method-mtime-name-password-tempminiarcHandle nativeHandle fileName ?options?optioninvalid level: must be between 1 and 9filename too longFILEZL%ld%lu%luCEr-translationbinary1.2.3%lldheadersfilename password encryptedPasswordr+-translationbinaryCRAPbad end of central directory recordCRAPFILEbad central file recordEminiarc::tar::addfileminiarc::tar0.1miniarc::zip::addfileminiarc::zip0.1miniarc::crap::cryptFileminiarc::crap::none::addfileminiarc::crap::zlib::addfileminiarc::crap0.1miniarc::crap::none0.1miniarc::crap::zlib0.1miniarc::gzipminiarc::gunzipminiarc0.1-chan-copychan-final-init-log2base-maxbytes-string-updateoptionsha1%dsha1%dsha1argv0miniarcinstallkitinstallkit::librarypathinstallkit::loadMiniarc::installkit::infoenvTCLLIBPATH/installkitvfs/lib/tclenvTCL_LIBRARY/installkitvfs/lib/tclenvTK_LIBRARY/installkitvfs/lib/tkenvITCL_LIBRARY/installkitvfs/lib/itclenvTILE_LIBRARY/installkitvfs/lib/tile/installkitvfs/boot.tcl::installkit::wrappedadler32crc32compressdeflatedecompressinflateoption data ?...?option1.2.31.2.3zlibzlib1.0-archive-compressedsize-crc-mount-offset-uncompressedsizezvfs/%s/%sfailed to initialize zvfsarchive not mounted by zvfsr-translationbinaryPKbad end of central directory recordPKbad central file record1.2.3zip/r-translationbinaryPKbad central file record1.2.3zvfs%x%xstale file handle?zipFile? ?mountPoint?mountPointzvfs1.0zvfs::mountzvfs::unmountintendlen%dautolfbinarycrcrlfplatformParseTranslationOption bugFormatTranslationOption bugfulllinenoneTclX_GetChannelOption bug TclX_SetChannelOption bugliststringinvalid TclX result save objecttclx_%s%d%duseruseridgroupgroupiduseruseridgroupgroupidparentgroupset%dconverteffectiveprocessgroupsgroupidshostuseruseridgroupgroupidid/bin/shshTcl_CallFrame and CallFrame are not the same sizeTcl_CreateInterp: can't create global namespaceTcl_CreateInterp: builtin command with NULL string and object command procs and a NULL compile proc Tcl_CreateInterp: Tcl_CreateMathFunc incorrectly registered '%s'tcl_platformbyteOrdertcl_platformwordSizetcl_patchLevel8.4.14tcl_version8.4tcl_precisionTcl8.48.4Assoc Data Key #%dDeleteInterpProc called with active evalsDeleteInterpProc called on interpreter not marked deleted::::::::::::attempt to call eval in deleted interpretertoo many nested evaluations (infinite loop?)::unknown while executing "%.*s%s" invoked from within "%.*s%s"unexpected token type in Tcl_EvalTokensStandardmissing close-bracketmissing close-bracketinvoked "break" outside of a loopinvoked "continue" outside of a loopcommand returned bad code: %dillegal argument vectorunknownunknown while invoking " invoked from within "... "%ldNONETcl_SetByteArrayObj called with shared objectTcl_SetObjLength called with shared objectformatscanoption ?arg arg ...?optionformatString ?arg arg ...?value formatString ?varName varName ...?unable to alloc %u bytesunable to alloc %u bytes, %s line %dunable to realloc %u bytesunable to realloc %u bytes, %s line %dclicksformatscanseconds-format-gmt-base-gmtoption ?arg ...?option-milliseconds?-milliseconds?clockval ?-format string? ?-gmt boolean?switchdateString ?-base clockValue? ?-gmt boolean?switchenvTZenvTZGMT0envTZenvTZstring ?in? patList body ... ?default body?inextra case pattern with no bodydefault ("%.50s" arm line %d)command ?varName?couldn't save command result in variable?dirName?~convertfromconverttonamessystemoption ?arg ...?option?encoding? data?encoding?message ?errorInfo? ?errorCode?errorCodearg ?arg ...? ("eval" body line %d)?returnCode?arg ?arg ...? atimeattributeschannelscopydeletedirnameexecutableexistsextensionisdirectoryisfilejoinlinklstatmtimemkdirnativenamenormalizeownedpathtypereadablereadlinkrenamerootnameseparatorsizesplitstatsystemtailtypevolumeswritableoption ?arg ...?optionname ?time??pattern?name ?name ...??-linktype? linkname ?target?-symbolic-hardswitchname varNamename ?time?name ?name ...?filenameabsoluterelativevolumerelative?name?Unrecognised pathstat name varNameUnrecognised pathnamedevinonlinkuidgidsizeatimemtimectimemodetypestart test next command ("for" initial command) ("for" body line %d) ("for" loop-end command)varList list ?varList list ...? commandforeach varlist is emptyTcl_ForeachObjCmd: could not reconvert variable list %d to a list object Tcl_ForeachObjCmd: could not reconvert value list %d to a list object ("foreach" body line %d)formatString ?arg arg ...?llbad field specifier "%c"thenelseifelsevarName ?increment? (reading increment) (reading increment)argsbodycmdcountcommandscompletedefaultexistsfunctionsglobalshostnamelevellibraryloadedlocalsnameofexecutablepatchlevelprocsscriptsharedlibextensiontclversionvarsoption ?arg arg ...?optionprocnameprocname?pattern?commandprocname arg varnamevarName?pattern??pattern?unable to determine name of host?number?tcl_libraryno library has been specified for Tcl?interp??pattern?tcl_patchLevel?pattern??filename?.sotcl_version?pattern?list ?joinString?list ?index...?list index element ?element ...?listlist first lastlist first last ?element element ...?-all-ascii-decreasing-dictionary-exact-glob-increasing-inline-integer-not-real-regexp-sorted-start?options? list patternoptionlistVar index ?index...? value-ascii-command-decreasing-dictionary-increasing-index-integer-real-unique?options? listoption"-command" option must be followed by comparison command"-index" option must be followed by list index (-compare command)-compare command returned non-integer resultexecutioncommandvariable-all-about-indices-inline-expanded-line-linestop-lineanchor-nocase-start--switch?switches? exp string ?matchVar? ?subMatchVar subMatchVar ...?-all-nocase-expanded-line-linestop-lineanchor-start--switch?switches? exp string subSpec ?varName?&\*+?{}()[].\|^$oldName newName-codeokerrorreturnbreakcontinue-errorinfo-errorcodefileNamestring ?splitChars?bytelengthcompareequalfirstindexislastlengthmapmatchrangerepeatreplacetolowertouppertotitletrimtrimlefttrimrightwordendwordstartoption arg ?arg ...?option?-nocase? ?-length int? string1 string2-nocase-lengthsubString string ?startIndex?string charIndexalnumalphaasciicontrolbooleandigitdoublefalsegraphintegerlowerprintpunctspacetrueupperwordcharxdigitclass ?-strict? ?-failindex var? strclass-strict-failindex?-strict? ?-failindex var? strsubString string ?startIndex?string?-nocase? charMap string-nocasechar map list unbalanced?-nocase? pattern string-nocasestring first laststring count%dstring first last ?string?string ?first? ?last?string ?chars?string indexstring index-nobackslashes-nocommands-novariablesswitchTcl_SubstObjCmd: bad option index to SubstOptions?-nobackslashes? ?-nocommands? ?-novariables? string-exact-glob-regexp--option?switches? string pattern body ... ?default body??switches? string {pattern body ... ?default body?}-defaultfall-out when searching for body to match pattern- ("%.50s" arm line %d)command ?count?microsecondsperiterationaddinforemovevariablevdeletevinfooption ?arg arg ...?optiontype ?arg arg ...?optionname ops commandreadwriteunsetarraynameenterleaveenterstepleavestepname opList commandoperationTclTraceExecutionObjCmd: negative TraceCommandInfo refCountnameenterleaveenterstepleavestepdeleterenamename opList commandoperationTclTraceCommandObjCmd: negative TraceCommandInfo refCountnamerenamedeletearrayreadunsetwritename opList commandoperationtracenamearrayreadwriteunset rename deleteTraceCommandProc: negative TraceCommandInfo refCountTclCheckExecutionTraces: negative TraceCommandInfo refCountCommandObjTraceDeleted: negative TraceCommandInfo refCountenterenterstepleaveleavestepTraceExecutionProc: bad flag combinationTraceExecutionProc: negative TraceCommandInfo refCount a r w u array read write unsettest command ("while" body line %d)wrong # args: should be "append varName ?value value ...?"wrong # args: should be "break"wrong # args: should be "catch command ?varName?"TclCompileCatchCmd: bad jump distance %d wrong # args: should be "continue"wrong # args: should be "expr arg ?arg ...?"wrong # args: should be "for start test next command" ("for" initial command) ("for" body line %d) ("for" loop-end command) ("for" test expression)wrong # args: should be "foreach varList list ?varList list ...? command" ("foreach" body line %d)elseifwrong # args: no expression after "%.*s" argument ("if" test expression)wrong # args: no script following "%.*s" argumentthenwrong # args: no script following "then" argument ("if" then script line %d)elsewrong # args: no script following "else" argument ("if" else script line %d)wrong # args: extra words after "else" clause in "if" commandTclCompileIfCmd: unexpected opcode updating ifFalse jumpwrong # args: should be "incr varName ?increment?"wrong # args: should be "lappend varName ?value value ...?"-nocase*+?{}()[].\|^$wrong # args: should be "set varName ?newValue?"bytelengthcompareequalfirstindexislastlengthmapmatchrangerepeatreplacetolowertouppertotitletrimtrimlefttrimrightwordendwordstartoption%d-nocase*[]?\wrong # args: should be "while test command" ("while" body line %d) ("while" test expression)missing close-bracket (parsing index for array "%.*s")Unexpected token type in TclCompileTokens while compiling "%.*s%s"EnterCmdStartData: bad command index %d EnterCmdStartData: cmd map not sorted by code offsetEnterCmdExtentData: bad command index %d EnterCmdExtentData: missing start data for command %d TclFixupForwardJump: bad ExceptionRange type %d GetCmdLocEncodingSize: bad code offsetGetCmdLocEncodingSize: bad code lengthGetCmdLocEncodingSize: bad source lengthEncodeCmdLocMap: bad code offsetEncodeCmdLocMap: bad code lengthEncodeCmdLocMap: bad source length(%u) %s %d # pc %u%d%d # pc %u%d%u # TclPrintInstruction: bad local var index %u (%u locals) %u # temp var %u%u # var %u %u # TclPrintInstruction: bad local var index %u (%u locals) %u # temp var %u%u # var %u """\"\f\n\r\t\v%c"ama.m.pmp.m.identityutf-8unicodeencoding*.enc-encodingutf-8encoding.encrnameinitfinalEscapeToUtfProc: invalid sub tableenvenvenvenvenvHOMEenverrorInfoerrorCodetclBgErrortclBgErrorerrorInfoerrorCodebgerrorbgerror bgerror failed to handle background error. Original error: Error in bgerror: TclInitSubsystems called while finalizingnameidletasksoptionTcl_UpdateObjCmd: bad option index to UpdateOptions?idletasks?::errorInfo::errorCodeERROR: freeing an execEnv whose stack is still in use. Tcl_ExprObj: compiled expression jumped interpsTcl_EvalObj: compiled script jumped interpsERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FreadreadERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_Fsetset (reading increment)read (reading value of variable to increment)readERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FTclExecuteByteCode: unrecognized builtin function code %dERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FTclExecuteByteCode: unrecognized opCode %udivide by zeroERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_FERROR: bad usage of macro NEXT_INST_F TclExecuteByteCode: abnormal return at pc %u: stack top %d < entry stack top %d TclExecuteByteCode execution failure: end stack top < start stack topargument to math function was an invalid octal numberargument to math function didn't have numeric valueinteger value too large to representinteger value too large to representinteger value too large to representinteger value too large to represent (argument to "srand()")ExprCallMathFunc: expected number of args %d != actual number %dunknown floating-point error, errno = %d::tcl::CopyDirectorycopyingrenaming-force--name ?option? ?value? ?option value ...?optionoption^((/+([.][.]?/+)*([.][.]?)?)|(~[^:/]*)(/[^:]*)?|(~[^:]*)(:.*)?|/+([.][.]?/+)*([^:/]+)(/[^:]*)?|([^:]+):.*)$//////:/././:::::::://::/\:HOME-directory-join-nocomplain-path-tails-types--optionmissing argument to "-directory""-directory" cannot be used with "-path"missing argument to "-path""-path" cannot be used with "-directory"missing argument to "-types"?switches? name ?name ...?"-tails" must be used with either "-directory" or "-path"\/\[]*?{}\\[]*?{}readonlyhiddenmacintoshtypecreatorbad argument to "-types": only one MacOS type or creator argument to "-types" allowed./:::*[]?\*[]?\:/:/./.yesnotruefalseonoffmalformed bucket chain in Tcl_DeleteHashEntry%d entries in table, %d buckets number of buckets with %d entries: %d number of buckets with %d or more entries: %d average search distance for entry: %.1fcalled Tcl_FindHashEntry on deleted tablecalled Tcl_CreateHashEntry on deleted tablecan't convert value to index except via Tcl_GetIndexFromObj APIwrong # args: should be "interpInterpInfoDeleteProc: still exist commandsInterpInfoDeleteProc: still exist aliasesaliasaliasescreatedeleteevalexistsexposehidehiddenissafeinvokehiddenmarktrustedrecursionlimitslavessharetargettransfercmd ?arg ...?optionslavePath slaveCmd ?masterPath masterCmd? ?args ..?-safe--option?-safe? ?--? ?path?interp%dpath arg ?arg ...?path hiddenCmdName ?cmdName?path cmdName ?hiddenCmdName?-global--optionpath ?-global? ?--? cmd ?arg ..?pathpath ?newlimit?srcPath channelId destPathpath aliassrcPath channelId destPath?path?tcl_interactive0aliasaliasesevalexposehidehiddenissafeinvokehiddenmarktrustedrecursionlimitSlaveObjCmd: interpreter has been deletedcmd ?arg ...?optionaliasName ?targetName? ?args..?arg ?arg ...?hiddenCmdName ?cmdName?cmdName ?hiddenCmdName?-global--option?-global? ?--? cmd ?arg ..??newlimit?recursion limit must be > 0falling back due to new recursion limitnot allowed to invoke hidden commands from safe interpreterenvtcl_platformostcl_platformosVersiontcl_platformmachinetcl_platformusertclDefaultLibrarytcl_librarytcl_pkgPath-blockingontclIOtclIOTcl_RegisterChannel: channel without nameTcl_RegisterChannel: duplicate channel namestclIOstdinstdoutstderrTcl_CreateChannel: NULL channel namebinaryTclFlush, closed channel: queued output leftFlushChannel: damaged channel listTcl_SpliceChannel: trying to add channel used in different listcalled Tcl_Close on channel with refCount > 0iso8859-1Buffer Underflow, BUFFER_PADDING not enoughblocking buffering buffersize encoding eofchar translation malformed option list in channel driver-blocking-blocking-buffering-bufferinglinenonefull-buffersize-buffersize-encoding-encodingbinary-eofchar-eofchar%c%c-translation-translationautocrcrlflfautocrcrlflfauto-blocking-bufferingfulllinenone-buffersize-encodingbinary-eofchar-translationautobinarylfcrcrlfplatformautotcpbinarylfcrcrlfplatformreadablewritablechannelId event ?script?event nameunknown eol translation modeTcl_Write: AUTO output translation mode not supportedTcl_Write: unknown output translation modestdinstdoutstderrtclIOstdinstdoutstderr-nonewline-nonewlinenonewline?-nonewline? ?channelId? string channelIdchannelId ?varName?channelId ?numChars?-nonewlinenonewlinestartcurrentendchannelId offset ?origin?originchannelIdchannelIdchannelId ?optionName? ?value? ?optionName value?...channelId-keepnewline--switch?switches? arg ?arg ...?channelIdfileName ?access? ?permissions?Tcl_OpenCmd: invalid mode valuetclTCPAcceptCallbackstclTCPAcceptCallbacksRegisterTcpServerCleanup: damaged accept record tabletclTCPAcceptCallbacks-async-myaddr-myport-serveroptionTcl_SocketObjCmd: bad option index to SocketOptions-size-commandinput output ?-size size? ?-command callback?switchnative while processing open access modes ""RDONLYWRONLYRDWRAPPENDCREATEXCLNOCTTYNONBLOCKTRUNCr-eofchar (file "%.150s" line %d)0700./wr-translationbinary-translationbinaryTcl_FSGetFileSystemForPath called with object with refCount == 0//://:HOMECalled UpdateStringOfFsPath with invalid object//:Tcl_SetListObj called with shared objectTcl_ListObjAppendList called with shared objectTcl_ListObjAppendElement called with shared objectTcl_ListObjReplace called with shared objectlist index out of rangelist index out of rangeTcl_ListObjSetElement called with shared objectlist index out of rangeSetListFromAny: bad size estimate for liststring representation size exceeds sane boundsfileName ?packageName? ?interp?tclLoad_Init_SafeInittclLoadtclLoadtclLoadtclLoadtclLoadargv0argcargvtcl_interactiveapplication-specific initialization failed: errorInfo tcl_interactive tcl_interactivetcl_interactivetcl_interactivetcl_interactiveexit %d % (script that generates prompt) Trying to push call frame for dead namespace::errorInfoerrorCodeerrorInfoerrorCodeauto_importauto_importempty import pattern::DeleteImportedCmd: did not find cmd in real cmd's list of import referencesCould not create namespace '%s'childrencodecurrentdeleteevalexistsexportforgetimportinscopeoriginparentqualifierstailwhichsubcommand ?arg ...?option?name? ?pattern?::argnamespaceinscope::namespaceinscope::::?name name...?name arg ?arg...? (in namespace eval "%.200s" script line %d)name?-clear? ?pattern pattern...?-clear?pattern pattern...??-force? ?pattern pattern...?-forcename arg ?arg...? (in namespace inscope "%.200s" script line %d)name?name?stringstring?-command? ?-variable? name-command-variableUpdateStringProc should not be invoked for type %sUpdateStringProc should not be invoked for type %sTcl_SetBooleanObj called with shared objectyesnotruefalseonoffexpected boolean value but got "%.50s"Tcl_SetDoubleObj called with shared objectexpected floating-point number but got "%.50s"Tcl_SetIntObj called with shared objectinteger value too large to represent as non-long integerexpected integer but got "%.50s"Tcl_SetLongObj called with shared objectinteger value too large to representexpected integer but got "%.50s"%lldTcl_SetWideIntObj called with shared object ParseTokens encountered unknown character$child process lost (is SIGCHLD ignored or trapped?) ("package ifneeded" script) -exact ("package unknown" script)forgetifneedednamespresentproviderequireunknownvcompareversionsvsatisfiesoption ?arg arg ...?optionpackage version ?script??-exact? package ?version?-exactpackage ?version??-exact? package ?version?-exact?command?version1 version2packageversion1 version2Tcl_PackageObjCmd: bad option index to pkgOptionsE2BIGEACCESEADDRINUSEEADDRNOTAVAILEADVEAFNOSUPPORTEAGAINEALREADYEBADEEBADFEBADFDEBADMSGEBADREBADRQCEBADSLTEBFONTEBUSYECHILDECHRNGECOMMECONNABORTEDECONNREFUSEDECONNRESETEDEADLKEDEADLOCKEDESTADDRREQEDOMEDQUOTEEXISTEFAULTEFBIGEHOSTDOWNEHOSTUNREACHEIDRMEINPROGRESSEINTREINVALEIOEISCONNEISDIREL2HLTEL2NSYNCEL3HLTEL3RSTELIBACCELIBBADELIBEXECELIBMAXELIBSCNELNRNGELOOPEMFILEEMLINKEMSGSIZEEMULTIHOPENAMETOOLONGENETDOWNENETRESETENETUNREACHENFILEENOANOENOBUFSENOCSIENODATAENODEVENOENTENOEXECENOLCKENOLINKENOMEMENOMSGENONETENOPKGENOPROTOOPTENOSPCENOSRENOSTRENOSYSENOTBLKENOTCONNENOTDIRENOTEMPTYENOTSOCKENOTSUPENOTTYENOTUNIQENXIOEOPNOTSUPPEOVERFLOWEPERMEPFNOSUPPORTEPIPEEPROTOEPROTONOSUPPORTEPROTOTYPEERANGEEREMCHGEREMOTEEROFSESHUTDOWNESOCKTNOSUPPORTESPIPEESRCHESRMNTESTALEETIMEETIMEDOUTETOOMANYREFSETXTBSYEUNATCHEUSERSEXDEVEXFULLunknown errorargument list too longpermission deniedaddress already in usecan't assign requested addressadvertise erroraddress family not supported by protocol familyresource temporarily unavailableoperation already in progressbad exchange descriptorbad file numberfile descriptor in bad statenot a data messagebad request descriptorbad request codeinvalid slotbad font file formatfile busyno childrenchannel number out of rangecommunication error on sendsoftware caused connection abortconnection refusedconnection reset by peerresource deadlock avoidedresource deadlock avoideddestination address requiredmath argument out of rangedisk quota exceededfile already existsbad address in system call argumentfile too largehost is downhost is unreachableidentifier removedoperation now in progressinterrupted system callinvalid argumentI/O errorsocket is already connectedillegal operation on a directorylevel 2 haltedlevel 2 not synchronizedlevel 3 haltedlevel 3 resetcan not access a needed shared libraryaccessing a corrupted shared librarycan not exec a shared library directlyattempting to link in more shared libraries than system limit.lib section in a.out corruptedlink number out of rangetoo many levels of symbolic linkstoo many open filestoo many linksmessage too longmultihop attemptedfile name too longnetwork is downnetwork dropped connection on resetnetwork is unreachablefile table overflowanode table overflowno buffer space availableno CSI structure availableno data availableno such deviceno such file or directoryexec format errorno locks availablelink has be severednot enough memoryno message of desired typemachine is not on the networkpackage not installedbad protocol optionno space left on deviceout of stream resourcesnot a stream devicefunction not implementedblock device requiredsocket is not connectednot a directorydirectory not emptysocket operation on non-socketoperation not supportedinappropriate device for ioctlname not unique on networkno such device or addressoperation not supported on socketfile too bignot ownerprotocol family not supportedbroken pipeprotocol errorprotocol not supporedprotocol wrong type for socketmath result unrepresentableremote address changedpathname hit remote file systemread-only file systemcan't send afer socket shutdownsocket type not supportedinvalid seekno such processsrmount errorstale remote file handletimer expiredconnection timed outtoo many references: can't splicetext file or pseudo-device busyprotocol driver not attachedtoo many userscross-domain linkmessage tables fullSIGABRTSIGALRMSIGBUSSIGCHLDSIGCONTSIGEMTSIGFPESIGHUPSIGILLSIGINTSIGIOSIGKILLSIGLOSTSIGPIPESIGPROFSIGPWRSIGQUITSIGSEGVSIGSTOPSIGSYSSIGTERMSIGTRAPSIGTSTPSIGTTINSIGTTOUSIGURGSIGUSR1SIGUSR2SIGVTALRMSIGWINCHSIGXCPUSIGXFSZunknown signalSIGABRTalarm clockbus errorchild status changedcontinue after stopEMT instructionfloating-point exceptionhangupillegal instructioninterruptinput/output possible on filekill signalresource lostwrite on pipe with no readersprofiling alarmpower-fail restartquit signalsegmentation violationstopbad argument to system callsoftware termination signaltrace trapstop signal from ttybackground tty readbackground tty writeurgent I/O conditionuser-defined signal 1user-defined signal 2virtual time alarmwindow changedexceeded CPU time limitexceeded file size limitunknown signalTcl_Release couldn't find reference for 0x%xTcl_EventuallyFree called twice for 0x%x name args body::args": arg list contains %d entries, precompiled header expects %d": formal parameter %d is inconsistent with precompiled body?level? command ?arg ...? ("uplevel" body line %d)body of procTclObjInterpProc: local variable %s is not argument but should beTclObjInterpProc: local variable %d is temporary but should be an argumentargswrong # args: should be " (compiling %s "%.*s%s", line %d) (procedure "%.*s%s" line %d)called ProcBodySetFromAnycalled ProcBodyUpdateStringerror while matching regular expression: %u%dcouldn't compile regular expression pattern: errorCodeerrorCodeerrorInfoerrorInfoerrorCodestring format ?varName varName ...?%llu%luTcl_SetStringObj called with shared objectTcl_SetObjLength called with shared objectTcl_AttemptSetObjLength called with shared objectTcl_AppendToObj called with shared objectTcl_AppendUnicodeToObj called with shared objectTcl_AppendStringsToObj called with shared objectTclcancelidleinfooption ?arg arg ...?tclAftertclAfterafter#%dargumentid|commandscript script ...after#%dafter#%d?id?Tcl_AfterObjCmd: bad subcommand index to afterSubCmdsafter# ("after" script)list element in braces followed by "%.*s" instead of spacelist element in quotes followed by "%.*s" %s {{}%%.%dg%ldTclLooksLikeInt: cannot scan %d bytes from NULLend-endendno such variablevariable is arrayvariable isn't arrayno such element in arrayupvar refers to element in deleted arrayupvar refers to variable in deleted namespaceparent namespace doesn't existmissing variable namename refers to an element in an array::readreadreadvarName ?newValue?setsetsetsetsetread (reading value of variable to increment) (reading value of variable to increment)unsetunsettracebad result flag combination?-nocomplain? ?--? ?varName varName ...?-nocomplain--varName ?value value ...?setvarName ?value value ...?setanymoredonesearchexistsgetnamesnextelementsetsizestartsearchstatisticsunsetoption arrayName ?arg ...?optionarrayName searchIdarrayName searchIdarrayNamearrayName ?pattern?-exact-glob-regexparrayName ?mode? ?pattern?optionarrayName searchIdarrayName listarrayNamearrayNamearrayName ?pattern?setsetlist must have an even number of elementssetarray setaccessObjMakeUpvar called with an index outside from a proc. ::create::varName ?varName ...??name value...? name ?value?definedefine?level? otherVar localVar ?otherVar localVar ...?readsettrace arrayaccessERROR: scalar parsedVarName without a string rep. CTSDSRRINGDCD-mode-handshakeNONEXONXOFFRTSCTSDTRDSR-xchar-timeout-ttycontrolDTRRTSBREAKmode handshake timeout ttycontrol xchar -mode-mode%d,%c,%d,%d-xchar-xchar%c%c-queue%d%d-ttystatusmode queue ttystatus xchar%d,%c,%d,%d%nnoemsTclpOpenFileChannel: invalid mode value/dev/ttyfile%dauto crlf-translationserial%dfile%d-error-peername-peername-sockname-socknamepeername socknamesock%d-translationauto crlfsock%d-translationauto crlfsock%dsock%d-translationauto crlfTclGetDefaultStdChannel: Unexpected channel type-translationauto-translationauto crlf-bufferingpipeTclWaitForFile can't handle file id %d-group-owner-permissions...///..%0#5lo/PATH:/bin:/usr/bin.//././/var/tmp//tclXXXXXX/var/tmp//tclXXXXXX%dforked process couldn't set up input/output: %dcouldn't execute "%.150s": file%d?channelId?Stardate %2d%03d.%01dTZgb2312-1980gb2312ansi-1251cp1251ja_JP.SJISshiftjisja_JP.EUCeuc-jpja_JP.eucJPeuc-jpja_JP.JISiso2022-jpja_JP.mscodeshiftjisja_JP.ujiseuc-jpja_JPeuc-jpJa_JPshiftjisJp_JPshiftjisjapaneuc-jpjapaneseeuc-jpjaeuc-jpjapanese.sjisshiftjisjapanese.euceuc-jpjapanese-sjisshiftjisjapanese-ujiseuc-jpkoeuc-krko_KReuc-krko_KR.EUCeuc-krko_KR.euceuc-krko_KR.eucKReuc-krkoreaneuc-krruiso8859-5ru_RUiso8859-5ru_SUiso8859-5zhcp936zh_CN.gb2312euc-cnzh_CN.GB2312euc-cnzh_CN.GBKeuc-cnzh_TW.Big5big5zh_TWeuc-tw/dev/null/dev/null/dev/nulllib/tcl%stcl%s/libraryTCL_LIBRARY...librarylibraryansi_x3.4-1968iso8859-1LC_ALLLC_CTYPELANGiso8859-1Cidentityiso8859-1tclDefaultLibrarytcl_pkgPathtcl_platformplatformunixtcl_platformostcl_platformosVersiontcl_platformosVersiontcl_platformosVersion.tcl_platformosVersiontcl_platformmachinetcl_platformostcl_platformosVersiontcl_platformmachineUSERLOGNAMEtcl_platformusertcl_libPathtcl_rcFileNamer _ ========= RAW ========== ========= TREE FIXED ========== ========= LA%d ========== ========= SEARCH ========== ========= TREE NODE %s ========== null tree %s. `%c' longest shortest hasmixed hascapture hasbackref UNUSED (#%d) {%d,%d} %ld-%ld L:%s R:%s %d%p initial cleanup: empties: constraints: final cleanup: lowerupperalpha%dREG_%uCompileSubExpr: token type %d not TCL_TOKEN_SUB_EXPR CompileSubExpr: unexpected operator %d requiring special treatment CompileSubExpr: unexpected token type %d CompileLandOrLorExpr: bad jump distance %d too few arguments for math functiontoo many arguments for math functiontoo many arguments for math functionsyntax error in expression "%.*s"historyadd-blockingNULL??extra tokens at end of expressionmissing colon from ternary conditionallooking for close parenthesisexpected parenthesis enclosing function argumentsvariable references require preceding $missing close parenthesis at end of function callcommas can only separate function argumentspremature end of expressionsingle equality character not legal in expressionscharacter not legal in expressionsunexpected ternary 'then' separatorunexpected ternary 'else' separatorunexpected close parenthesisunexpected operator %ssyntax error in expression "%.60s..."syntax error in expression "%.*s"1.2.31.2.3%c%c%c%c%c%c%c%c%c%c: need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version1.2.31.2.3¤00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|000000000000 0|0y$0v00s<0pH0mT0j`0gl0dx0a0^0[0X0U0R0O0L0I0F0C0@0=0: 07,04801D0.P0+\0(h0%t0"0000000 0 00MaMMMMM ބ ޔx M( oToxo(d ooQ,$\ ! ! ! ! !,|D$<T<84<Q4t$<Q$\0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ_, *l *t * * * * * *V$\ , , , , , , ,|(8hdV`W,W8WD``]D X]L ]T<]\G_]dG]lJ`]t?]|L]M j]ML]O]P]Q]R$k]]P]nl@]p\t]z] ]l]$P]^0^ X^\^^ pt^(H^0 ^8D^@^LX^T^\4^dB^pˠ^x^^^^ (^ DD^ ߠ^^D^$h^(^/^ ^ ^ ^ 0^W,_ xD_K_ w _y_~h_$x _0TD_8o_@p_H_PT_X _\l_d_hr_pt_x_vh_-_0__z_(c| @L 4 40123456789abcdef 5 5 5 5 5 5 5 5 7| 7 7 7 8X 8` 8l 8x 8 8 8 8 8 8 8 8 8 8 8 8 8 8 9 9 9 9$ 90 98 9D 9P 9X 9` 9h 9p 9x 9 9 9 : = = =$ =0 =< =H =P =X =d =l =x = = = = = = = = = = ? ? ? ? ? ? ? @ @ @ @ @$ @, @4 @| @ @ @ @ @ @ @ @ A A A5 ;L@ A A A A A A A B B B B$ Bp Bx B B B B B B Ct C C C C C C C C C C C C C C C C C D D D D D D D D D D D D D E E E E E E( E0 E< F F F Gd Gl Gt G| H H H H H H I( I0 I8 ID I I J` Jh Jp JxmD Q$ Q0 Q8 Q@ QH QP QT Q\ Qd Qh Qp Qx Q Q Q Q Q Q Q Q Qmmmnnn nn n,n4n<nHnTndnpn|nnnnnnnnnooo o0o8oHo\olo|ooooooooooooooooppp pppp$p(p,p4p<pDpHp\phpxpppppppppppqq qq q,q8qHqXqhqxqqqqqqqqqrrrphDTr@rHrTr\rdrhrprxr r r r r rrrrrrrrrss s s s(s4s<s@ sH <sP <sT s\ s`slsxs s s ssss s s s s s ss <s xs s ss ss ,s,s hshs st tt t t XtXt Xt Xt$ t( t0 t4t< t@ tHtP tTtX t\t` td Lth .tl tp tt tx t| \t\t >t t tt tt tt tt t 0t 0t0t 0tt <t xt t t ,t hu u u u  Xu u u u u  Lu$ u( u, u0 \u4 u8 u< u@ luD 0uH upeLe\   Wvvvv v$v(v,v0v4v8v<v@vDvHvLvPvTvXv\v`vdvhvlvvvvvvvvvvvv/pv/pv/pv1xv/pv/pv/pv/pv/pv1x(v1x4w/p@w/pLw1xXw/pdw/ppw /p|w(/pˆw,/p”w44pw87Dw@8wD=wL?pwTBw\;8 o o o o o o oL|04 s s s s s s t t t t t t0 t< tL tT t\ td t t uD uL u u v v v v v$ v, v< vH v w |L |X } } } ~t ~ x      |l `T < X8 \ A ` }P l n l i| g m@  HDd84YpY[@Z<    ( 0 < D|vrxzy}Xpl`@p @ H T \ d l t |   P   ! !T ! @$0<L \lX j hT j i, Ĩ P xmL \RP\ " d?H  G S<}  X LT7 P5 L l |Đ4 (  \ Έ     Ĝ$ ( D | $ ` ΀ d  < ? w T)$ $ 8.<%h(4,;;  =3|T## .$$  @ x8 (4h  pP ` (Xt P ( $( MJt , L p ( x W 8 x P 4\@8<?==L?>\ P f Ĩk g< ^ hlLqHwl Udn,mPqHx| dkop<H8pw8z(l| Tqdw{ Z8 YH . . l H 4 85( v T`LD^40 , rLDa^Ǭ sXd vH H X3(d$\L̐@\4s,+8 0̘ͬ05, 7L X < * Ug\cpx )T | ܐ 3t3Lj{ C P (IP | d O Qp 8_hPl <j   H x$ 1 1faT50>\4 3`d4hX (c 3 )@ ` | l08 2, |) |  x   ,?X?p + d  2 ?@4 _lD '` noxmd h hi4i, k X o4 oL o o  & &PlT hp_ P  T  H rpx  < hhoHghg 8 8 t  X  < `t4<< t  x  U ] V W W X _8 ] `fdf m l,44jLjdjkk k8kPkhkkkkkk ihi<  `p(EF|G==>> [ X4$D%XXx|,L \H 0$u,<, llpӜ 844 |p,l`,|-0l lH   !"#$%&'()*+,-.//01234#/5##########6789:;<=>?@ABCDE:FGHIJKLMNOPQRSPQTUPVWXYZ[\#]^_#`abcdef#/gh##ijk//l//m/no/p/qrstr/uv#//wZ//////////////////xy//z####/{|}~//###############################################################################################Z/Z///##ŠƠ/////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////##/////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////##////////////////////////////////////#########################################################/////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////##/////////######//////////////#///##########################################################################################################################///////////////////////////////////////////////////////////////////////////////////########################################/#########################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################            !"#$#%&'''(()*+****,-.,-.,-./,-.0123445647899:;<<<==>????????? ??????? ?? ????? ?@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@A@@@@@@@@@@@@ ? BCCCDEE FGGG H IJJKLMMMNOPQ/RSTTTTTTTTTTTTTTTT QQQQQQQQQQQQQQQQ@@@@UUMVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV?WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@********************************************************?**********@@@@@@@@@@@ @********************************************************************@@@@@@@UU@@@@@@??@@@@@@ ***X*@***************************@@@@@@@@@@@@@@@@@@@@@@@@@@@******@@@@@@@@@@@@@Y*****************************************************@*YYY@@@@@@@@YYYY@*@@@@**********@@ @YY********************************************@YYY@@@@YYYY@Y*****@@ **@*******************************************@YYY@@@@@@@***** @@***@@Y***********************************************@*YYY@@@@@@@YYY@** **********************@*Y@Y@@@YYYY@@Y***** @Y**********************************YY@YYYYYYYY@Y YYY*************************************************@@@YYYY@@@@@@@@@** YY*************************************************Y@YYYYY@YYYY@@YY**************************YYY@@@YYYYYY@YYY***********************************************************@YYY@@@@YYYYYYYYYY************************************************@**@@@@@@@******?@@@@@@@@ *****************************@**@@@@@@@@******?@@@@@@ ***@@ @@@YY******************************************@@@@@@@@@@@@@@Y@@@@@@@****@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@*********Y@@@@Y@@@Y@ ******YY@@MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM************************************************************************************************************************************************************************************************************************************************************************************************************************* *******************************************************************************ZZZ********************YYY@@@@@@@YYYYYYYY@YY@@@@@@@@@@@ XXXX ***?*************************************************************@[\\\\\\\\]]]]]]]]\\\\\\]]]]]]\\\\\\\\]]]]]]]]\\\\\\\\]]]]]]]]\\\\\\]]]]]]\\\\]]]]\\\\\\\\]]]]]]]]^^____``aabbcc\\\\\\\\dddddddd\\\\\\\\dddddddd\\\\\\\\dddddddd\\e]]ffg h eiiiig \\]]jj \\k]]llm ennoog XXXXpqXXXXX XXXXXX@@@@@@@@@@@@@UUUU@UUMMMMMMMMMMMMMMMrMstMMMMM****uuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvZZZZwwwwwwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxxx?*ZZZZZZZZZZ@@@@@@?????ZZZ*********************@@ ??*************************** ???*******************************************************************************************************************yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz***************@******************************************************************************************************************************************************************************************@@@@  *******************************************X   **********?*********************************************??**************************************************** XXX***{{{~~Y@MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM **XXXXXXXzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz  A F@@A@@A:AK4A3A3@AA2A2A3A4A4@A5@A5A6A6@A6Aa@AA433@2234@45@566@6 A @AAA @@ AA A  ACAC @AA@A@AAA A@AAJ]AA12%.12g @  D t  )l ) ) * + +T ,$ ,  0 8 D L P X d h p |  p . - .$ . 0, 0 -h /x 0 - .$ 1 8 0, 0 -h| F F F GH KD K D2Kn,X  `  % KK,X T H , L if {[info proc tclInit]==""} { proc tclInit {} { global tcl_libPath tcl_library errorInfo global env tclDefaultLibrary rename tclInit {} set errors {} set dirs {} if {[info exists tcl_library]} { lappend dirs $tcl_library } else { if {[info exists env(TCL_LIBRARY)]} { lappend dirs $env(TCL_LIBRARY) } catch { lappend dirs $tclDefaultLibrary unset tclDefaultLibrary } set dirs [concat $dirs $tcl_libPath] } foreach i $dirs { set tcl_library $i set tclfile [file join $i init.tcl] if {[file exists $tclfile]} { if {![catch {uplevel #0 [list source $tclfile]} msg]} { return } else { append errors "$tclfile: $msg $errorInfo " } } } set msg "Can't find a usable init.tcl in the following directories: " append msg " $dirs " append msg "$errors " append msg "This probably means that Tcl wasn't installed properly. " error $msg } } tclInit/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/lib/tcl8.4/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/lib [[:digit:]][^[:digit:]][:digit:][[:space:]][^[:space:]][:space:][[:alnum:]_][^[:alnum:]_][:alnum:]_alertESC      $ ( 4 8 HLPTX\`dhlptx| !"#$%&' ( )4*@+L,T-\-l.t.//0123456789:;<=>?(@8[L\X\h]^^__`{{|}}~ AZaz"3P1Va!:@Jq,  9 X a   ( * 0 Y \ r t   ( * 0 6 9 _ a     ( * 3 5 9     ( * 9 0@F@GIj!#'PUY_FJMPVZ]` FHZlov w EHMPW_}! !!!!*!-!/!1!3!901050A0000011,111114MNף-(*68@ACDt09`i f o f o f o f o f oPY )@Iiq!#%*,/[]Z_jm :=JOah  ' 0 C H M0000000DIRTa ;=ae:;?@_{}~  d e p OZ[mn E F } ~ #)#*000>?chjk ?[]  ( ) /0az~P0_a '07@EPW`gp}AZ   !#%')+-/13578:<>@BDFHIKMOQSUWY[]_acegikmoqsuwz|   #%')+-/13acegikmoqsuwy{}   !#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{} ! !!!!/!4!9AZ/1V(/8?HMho! ! !!!!!*!-!:   "$&(*,.02469;=?ACEGJLNPRTVXZ\^`bdfhjlnprtvxy{}  "$&(*,.02`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~Y[]_!!!!$!&!(!0!1!3!~!"3P!N`b!1VY_a!:@U`mp !,0J     ! 9 < M P T X p    ! ( * 0 > B K M Y \ f t      ! ( * 0 6 9 < C K M _ a f p        ! ( * 3 5 9 > D F H J M f o      ! ( * 9 > C F H J M f o !:?[!GIjq#',269@Y!Y_!FJMPVZ]`!FHZa|!!!v !w!!EHMPW_}   ! ) / F H M t !!!!!:!S!!!"""!"###!#{#}#$$$!$&$@$J$`$%%%!%%%&&&&&!&q'''' ' ''!''')'K'O'R'X'^'a'g'v'''''(((!(....///!///000!0:0A00000111!1,11111222!2C2`2{222222333!3v3{333444!55!66!77!88!99!::!;;!<>!??!@@!AA!BB!CC!DD!EE!FF!GG!HH!II!JJ!KK!LL!MM!MNNN!OO!PP!QQ!RR!SS!TT!UU!VV!WW!XX!YY!ZZ![[!\\!]]!^^!__!``!aa!bb!cc!dd!ee!ff!gg!hh!ii!jj!kk!ll!mm!nn!oo!pp!qq!rr!ss!tt!uu!vv!ww!xx!yy!zz!{{!||!}}!~~!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!¤Ĭ!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!ף!!-!680?>@ACDt$,4<DLT\dlt|*** unknown regex error code 0x%x ***$0HTp|   8D \h x 8D\`h7l8p9tx|34/012-.,+*=<IJ x t ň (  ( $(,048<@DL\`dhlptx|    , rc4ccrapvfs:boot.tcl is not a crapvfs mount/no argument given for rc4cno argument given for Bad -level. Must be between 0 and 9.cannot open "": no such file or directoryfailed to open "" for outputno argument given for cannot open "": no such file or directoryfailed to open "" for outputerror adding "": no such file or directoryno argument given for error adding "": no such file or directoryno argument given for unexpected zlib deflate error: ::miniarc:::infoerror adding "": no such file or directoryno argument given for ::miniarc:::infoerror adding "": no such file or directoryno argument given for unexpected zlib deflate error: ::miniarc:::infocannot open "": no such file or directorychan "" wasn't opened for readingcopychan "" wasn't opened for writingparameter to -log2base "" must be integer in range 1...6invalid sha1 descriptor "": : wrong # args: should be either: ?-log2base log2base? -string string or ?-log2base log2base? ?-copychan chanID? -chan chanID or -init (returns descriptor) -update descriptor ?-maxbytes n? ?-copychan chanID? -chan chanID (any number of -update calls, returns number of bytes read) ?-log2base log2base? -final descriptor The default log2base is 4 (hex)rc4c/installkitvfs/installkitvfs/main.tclzvfs: is not a zvfs mount/cmdstr1 ?cmdstr2...?systemerrorInfoerrorCodewrong # args: expected unsigned integer, got ""endlenchannel "" wasn't opened for readingchannel "" wasn't opened for writingchannel "" wasn't opened for readingchannel "" wasn't opened for writingautolfbinarycrcrlfplatformautolfcrcrlfplatform-blocking-buffering-translationfulllinenone-blocking10-bufferingfulllinenone-translation unknown user id: unknown user id: unknown group id: unknown group id: convert type valueuseruseridgroupgroupidthird arg must be "user", "userid", "group" or "groupid", got ""effective typeuseruseridgroupgroupidthird arg must be "user", "userid", "group" or "groupid", got ""process ?parent|group? ?set?parent process parentgroupset process group ?set?can't set process group from a safe interpeterexpected one of "parent" or "group" got""argunknown group id: hostarg ?value?user "" does not existgroup "" does not existarg ?arg...?converteffectiveprocessgroupsgroupidshostuseruseridgroupgroupidsecond arg must be one of "convert", "effective", "process", "user", "userid", "group", "groupid", "groups", "groupids", or "host"couldn't create pipe: couldn't set close on exec for pipe: couldn't fork child process: -ccouldn't execing /bin/sh: wait failed: SYSTEMSIGsystem command terminate with signal system command child stoppedappendarraybinarybreakcasecatchclockconcatcontinueencodingerrorevalexitexprfcopyfileeventforforeachformatglobalifincrinfojoinlappendlindexlinsertlistllengthloadlrangelreplacelsearchlsetlsortnamespacepackageprocregexpregsubrenamereturnscansetsplitstringsubstswitchtraceunsetuplevelupvarvariablewhileaftercdcloseeoffblockedfconfigurefileflushgetsglobopenpidputspwdreadseeksockettelltimeupdatevwaitexecsourcelittleEndianbigEndiancannot use namespace qualifiers in hidden command token (rename)can only hide global namespace commands (use rename then hide)hidden command named "" already existscan not expose to a namespace (use expose to toplevel, then rename)unknown hidden command ""trying to expose a non global command name space commandexposed command "" already existscan't deleterename "": command doesn't existcan't rename to "": bad command namecan't rename to "": command already existsmath function "" not known in this interpreterCOREIDELETEattempt to call eval in deleted interpreterinvalid command name ""......integer value too large to represent as non-long integerexpression didn't have numeric valueinteger value too large to represent as non-long integerexpression didn't have numeric valueinvalid hidden command name ""invalid command name ""0bytearraynumber of elements in list does not match countcannot use "*" in format string with "x"binaryhexadecimalexpected string but got "" insteadmissing count for "@" field specifiernot enough arguments for all format specifiersbad field specifier ""%a %b %d %X %Z %Ybad switch "": must be -millisecondsunable to convert date-time string ""bad format string ""couldn't change working directory to "": could not set access time for file "": could not create new link "": that path already existscould not create new link "" since target "" doesn't existcould not create new link "" pointing to "": could not read link "": could not set modification time for file "": could not readlink "": /\:could not read "": filedirectorycharacterSpecialblockSpecialfifolinksocketunknowncouldn't set loop variable: ""format string ended in middle of field specifiercannot mix "%" and "%n$" conversion specifiers"%n$" argument index out of rangenot enough arguments for all format specifierswrong # args: no expression after "" argumentwrong # args: no script following "" argumentwrong # args: no script following "else" argumentwrong # args: extra words after "else" clause in "if" command"" isn't a procedure"" isn't a procedure"" isn't a procedurecouldn't store default value in variable ""procedure "" doesn't have an argument ""bad level "" list doesn't contain element missing starting indexelement missing from sublist ""regexp match variables not allowed when using -inlinecouldn't set variable ""couldn't set variable ""bad completion code "": must be ok, error, return, break, continue, or an integerbad option "": must be -code, -errorcode, or -errorinfo bad option "": must be -nocase or -lengthbad option "": must be -strict or -failindexbad option "": must be -nocasebad option "": must be -nocasestring size overflow, must be less than extra switch pattern with no body, this may be due to a comment incorrectly placed outside of a switch body - see the "switch" documentationno body specified for pattern ""bad operations "": should be one or more of rwuabad operation list "": must be one or more of enter, leave, enterstep, or leavestepbad operation list "": must be one or more of delete or renamebad operation list "": must be one or more of array, read, unset, or writeForeachInfo0wrong # args: should be "llength list"1donepush1push4popdupconcat1invokeStk1invokeStk4evalStkexprStkloadScalar1loadScalar4loadScalarStkloadArray1loadArray4loadArrayStkloadStkstoreScalar1storeScalar4storeScalarStkstoreArray1storeArray4storeArrayStkstoreStkincrScalar1incrScalarStkincrArray1incrArrayStkincrStkincrScalar1ImmincrScalarStkImmincrArray1ImmincrArrayStkImmincrStkImmjump1jump4jumpTrue1jumpTrue4jumpFalse1jumpFalse4lorlandbitorbitxorbitandeqneqltgtlegelshiftrshiftaddsubmultdivmoduplusuminusbitnotnotcallBuiltinFunc1callFunc1tryCvtToNumericbreakcontinueforeach_start4foreach_step4beginCatch4endCatchpushResultpushReturnCodestreqstrneqstrcmpstrlenstrindexstrmatchlistlistindexlistlengthappendScalar1appendScalar4appendArray1appendArray4appendArrayStkappendStklappendScalar1lappendScalar4lappendArray1lappendArray4lappendArrayStklappendStklindexMultioverlsetListlsetFlatbytecode ......januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaytuesdaytueswednesdaywednesthursdaythurthursfridaysaturdayyearmonthfortnightweekdayhourminuteminsecondsectomorrowyesterdaytodaynowlastthisnextagoepochstardategmtututcuctwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetcestmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6wastwadtjtcctjstjdtkstkdtcastcadteasteadtgstnztnzstnzdtidledstabcdefghiklmnopqrstuvwxyzyacc stack overflowsyntax errorencodinginvalid encoding file "" or missing sub-encodingunknown encoding ""no such variablecan't wait for variable "": would wait forever||&&|^&==!=<><=>=<<>>+-*/%+-~!BUILTIN FUNCTIONFUNCTIONeqneacosasinatanatan2ceilcoscoshexpfloorfmodhypotloglog10powsinsinhsqrttantanhabsdoubleintrandroundsrandwide0ARITHDIVZEROdivide by zerocan't use empty string as operand of ""non-numeric stringnon-numeric floating-point valueinfinite floating-point valueinvalid octal numberinteger value too large to representARITHIOVERFLOWinteger value too large to representfloating-point valuecan't use as operand of ""ARITHIOVERFLOWinteger value too large to representARITHIOVERFLOWinteger value too large to representARITHIOVERFLOWinteger value too large to representARITHIOVERFLOWinteger value too large to representunknown math function ""domain error: argument not in valid rangeARITHDOMAINfloating-point value too small to representARITHUNDERFLOWfloating-point value too large to representARITHOVERFLOWARITHUNKNOWNwrong # args: should be " ?options? source ?source ...? target"error copyingrenaming: target "" is not a directorycan't create directory "": wrong # args: should be " ?options? file ?file ...?"error deleting "": directory not emptyerror deleting unknown file: error deleting "": can't overwrite file "" with directory ""can't overwrite directory "" with file ""error renaming "" to "": trying to rename a volume or move a directory into itselfcan't unlink "": error copying "error renaming "" to "": "": bad option "": should be -force or --could not read "": bad option "", there are no file attributes in this filesystem.bad option "", there are no file attributes in this filesystem.value for "" missingcouldn't find HOME environment variable to expand pathuser "" doesn't exist//\::no files matched glob pattern "s " "//\:/::}unmatched open-brace in file nameunmatched close-brace in file name,:.expected integer but got ""integer value too large to representARITHIOVERFLOWexpected integer but got ""integer value too large to representARITHIOVERFLOWexpected floating-point number but got ""expected boolean value but got ""indexambiguous bad "": must be , or or , "cannot delete the current interpreteralias "" in path "" not foundtarget interpreter for alias "" in path "" is not my descendantalias "" not foundalias "" not foundcannot define or rename alias "": interpreter deletedcannot define or rename alias "": would create a loopalias "" not foundcould not find interpreter ""interpreter named "" already exists, cannot createpermission denied: safe interpreter cannot expose commandspermission denied: safe interpreters cannot change recursion limitpermission denied: safe interpreter cannot hide commandspermission denied: safe interpreter cannot mark trustedIllegal recursive call to close through close-handler of channelcan not find channel named ""couldn't find state for channel ""reading and writing both disallowed for channel ""could not flush channel ""could not flush channel ""unable to access channel: invalid channelIllegal recursive call to close through close-handler of channelbad option "": should be one of -, or -01unable to set channel options: background copy in progressbad value for -buffering: must be one of full, line, or nonebad value for -eofchar: should be a list of zero, one, or two elementsbad value for -translation: must be a one or two element listbad value for -translation: must be one of auto, binary, cr, lf, crlf, or platformbad value for -translation: must be one of auto, binary, cr, lf, crlf, or platformchannel is not readablewritablechannel "" is busychannel "" is busyerror reading "": error writing "": error setting blocking mode: stdoutstdoutbad argument "": should be "nonewline"channel "" wasn't opened for writingerror writing "": channel "" wasn't opened for writingerror flushing "": channel "" wasn't opened for readingerror reading "": or " ?-nonewline? channelId"channel "" wasn't opened for readingbad argument "": should be "nonewline"error reading "": error during seek on "": error reading output from command: channel "" wasn't opened for readingr cannot set -async option for server socketsno argument given for -myaddr optionno argument given for -myport optiontcpcannot set -async option for server socketsno argument given for -server optionOption -myport is not valid for serverswrong # args: should be either: ?-myaddr addr? ?-myport myport? ?-async? host port -server command ?-myaddr addr? porttcpchannel "" wasn't opened for readingchannel "" wasn't opened for writingcouldn't open socket: port number too highglob couldn't determine the current working directoryillegal access mode ""invalid access mode "": must be RDONLY, WRONLY, RDWR, APPEND, CREAT EXCL, NOCTTY, NONBLOCK, or TRUNCaccess mode must include either RDONLY, WRONLY, or RDWRcouldn't read file "": couldn't read file "": couldn't read file "": POSIXcould not seek to end of file while opening "": couldn't open "": couldn't load library "": /\:pathcan't find objectstring representationcan't find objectstring representationcouldn't find HOME environment variable to expand pathuser "" doesn't existlistmust specify either file name or package namefile "" is already loaded for package ""package "" isn't loaded staticallycouldn't figure out package name for couldn't find procedure can't use package in a safe interpreter: no _SafeInit procedure{} {{} {10tcl_prompt2tcl_prompt1nsNamecan't create namespace "": only global namespace can have empty namecan't create namespace "": already existsinvalid export pattern "": pattern can't specify a namespaceunknown namespace in import pattern ""no namespace specified in import pattern ""import pattern "" tries to import from namespace "" into itselfimport pattern "" would create a loop containing command ""can't import command "": already existsunknown namespace in namespace forget pattern ""unknown namespace ""unknown command ""unknown variable ""unknown namespace "" in namespace children commandunknown namespace "" in namespace delete commandunknown namespace "" in inscope namespace commandinvalid command name ""unknown namespace "" in namespace parent commandbooleandoubleintwideIntcmdNameinteger value too large to representARITHIOVERFLOWinteger value too large to representARITHIOVERFLOWinteger value too large to representARITHIOVERFLOWcan't parse a NULL pointerextra characters after close-quoteextra characters after close-bracemissing close-bracketmissing close-brace for variable namemissing )missing close-brace: possible unbalanced brace in commentmissing "channel "" wasn't opened for writingreadingcouldn't writeread file "": can't specify "" as last word in commanderror waiting for process to exit: CHILDSTATUSCHILDKILLEDchild killed: CHILDSUSPchild suspended: child wait status didn't make sense error reading stderr output file: child process exited abnormallyillegal use of | or |& in commandcan't specify "" as last word in commandmust specify "" as last word in commandillegal use of | or |& in commandcouldn't create input file for command: couldn't create input pipe for command: couldn't create output pipe for command: couldn't create error file for command: couldn't create pipe: can't read output from command: standard output was redirectedcan't write input to command: standard input was redirectedpipe for command could not be createdconflicting versions provided for package "": , then Cannot load package "" in standalone executable: This package is not compiled with stub supportcircular package dependency: attempt to provide requires attempt to provide package failed: no version of package providedattempt to provide package failed: package provided insteadattempt to provide package failed: bad return code: {}bad return code: can't find package version conflict for package "": have , need version conflict for package "": have , need package is not presentpackage is not presentexpected version number but got ""procbodycan't create procedure "": unknown namespacecan't create procedure "": bad procedure namecan't create procedure "" in non-global namespace with name starting with ":"procedure "too many fields in argument specifier ""procedure "" has argument with no nameprocedure "" has formal parameter "" that is an array elementprocedure "" has formal parameter "" that is not a simple nameprocedure "procedure "": formal parameter "" has default value inconsistent with precompiled bodybad level "" ?? "a precompiled script jumped interps......invoked "break" outside of a loopinvoked "continue" outside of a loop......NONEregexpREG_UBACKREFREG_ULOOKAHEADREG_UBOUNDSREG_UBRACESREG_UBSALNUMREG_UPBOTCHREG_UBBSREG_UNONPOSIXREG_UUNSPECREG_UUNPORTREG_ULOCALEREG_UEMPTYMATCHREG_UIMPOSSIBLEREG_USHORTEST {}...REGEXPcannot mix "%" and "%n$" conversion specifiersfield width may not be specified in %c conversion'l' modifier may not be specified in % conversionunmatched [ in format stringbad scan conversion character ""variable is assigned by multiple "%n$" conversion specifiersvariable is not assigned by any conversion specifiers"%n$" argument index out of rangedifferent numbers of variable names and field specifierscouldn't set variable ""stringThis interpreter does not support stubs-enabled extensions.bad argument "": must be cancel, idle, info, or a numberevent "" doesn't existidletimerend-offsetinstead of spaceunmatched open brace in listunmatched open quote in listinternal error in Tcl_SplitListcan't modify precision from a safe interpreterimproper value for precision0123456789bad index "": must be integer or end?-integer?bad index "": must be end?-integer?bad index "": must be integer or end?-integer? (looks like invalid octal number)localVarNamenamespaceVarNameparsedVarNamearray searchs-1-s--error reading array statistics"" isn't an arraybad variable name "": upvar won't create namespace variable that refers to procedure variablecan't upvar from variable to itselfvariable "" has traces: can't use for upvarvariable "" already existsillegal search identifier ""search identifier "" isn't for variable ""couldn't find search ""can't "()": filettytcp10101010-handshake DTRDSR not supported for this platformbad value for -handshake: must be one of xonxoff, rtscts, dtrdsr or nonebad value for -xchar: should be a list of two elementsbad value for -ttycontrol: should be a list ofsignal,value pairsbad signal "" for -ttycontrol: must be DTR, RTS or BREAKbad value for -mode: should be baud,parity,data,stop parity: should be n, o, e, m, or s data: should be 5, 6, 7, or 8 stop: should be 1 or 2couldn't open "": can't get peername: can't get sockname: couldn't open socket: couldn't open socket: linelinenone"" wasn't opened for writing"" wasn't opened for readingwrcannot get a FILE * for """" cannot be used to get a FILE *could not read "": could not read "": could not read "": could not set group for file "": group "" does not existcould not set group for file "": could not set owner for file "": user "" does not existcould not set owner for file "": could not read "": unknown permission string format ""could not set permissions for file "": couldn't read directory "": error getting working directory name: pipecouldn't create pipe: couldn't fork child process: 8.48.4.14couldn't load file "": unableNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USspaceexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELalnumalphaasciiblankcntrldigitgraphlowerprintpunctspaceupperxdigitREG_OKAYno errors detectedREG_NOMATCHfailed to matchREG_BADPATinvalid regexp (reg version 0.8)REG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEinvalid escape \ sequenceREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets [] not balancedREG_EPARENparentheses () not balancedREG_EBRACEbraces {} not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEout of memoryREG_BADRPTquantifier operand invalidREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex functionREG_MIXEDcharacter widths of regex and string differREG_BADOPTinvalid embedded optionoops*/%+-<<>><><=>===!=&^|&&||?!~eqne01unknown math function ""transform failed to stack channel ""create/writecreate/readdelete/writeflush/writeflush/readdelete/writedelete/readquery/maxReadflush/readreadwriteflush/writeclear/readflush/writeclear/readinternal error: bad linked variable typelinked variable is read-onlyinternal error: linked variable couldn't be readvariable must have integer valuevariable must have integer valuevariable must have real valuevariable must have boolean valueinternal error: bad linked variable typeLITERALFUNCNAME[{()$",ENDUNKNOWNUNKNOWN_CHAR*/%+-<<>><><=>===!=&^|&&||?:!~eqnemissing close-bracket: 1.2.3incorrect header checkunknown compression methodinvalid window sizeunknown compression methodunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length code w y w z x |  $ , 8 @ L X d l x    $ ( 0 @ L \ d t    $ , 8 < D T \ l t (xx(ǠǬ ϐ ބ ޔ ޠ |¤ÈQ,,66ð<ôOä]i ޠ xøi ޤ |D,  ` 4 $ 1< IT R4 ] q< 8d   T 4 <8 d@  t   $ #< 3x9Ը @< \ iD zP $< p   tp D H Ĩi ި ĨD #4< 0p, >\ P d  n  0     8  X$   @   & ?$` ZļaļAiuF  F  Q 0ut u@  i P xP /D6D@`|, ( 8` 4  1 I R4 ] qh dd     8 @`\ 0     # 3tO|Xx @}T \~ i\x [$P ft< r X  ,| D    $X  XX! 8|h O hdL  h   x   H    P p\ \  (܀d : R i( @   t  @`  L  &3 44| AD ?8 @` E@ J  (,0eL e\  " 1A8Ol` ZL mP  t  hl tH$ t@  v| wT ~ L 0 !d 2 @0 P bX qh0 ~ DDHL | LTTX` L| $ 3 @lMl]pm/p {1x 4p 7DX 88 = ?p B ;8D H t pi $P ;* K' bD8L s- -h /X 1` 4X 8  ;  =  ?(8 #D  H :DJ SY cR u[0 P Pa(| a\ b  n o<p p  x   &L 3H Dl T|X b0L t@ d 0 $0 p 0 P 4\ < DD 2D Iؔ ST a< mL yl ,d ٨,  X X   p` 8 Ԑ  ֠ \ +l8 A( XT T` p(  D H +h J l,  hH "h 6 C P2L e $ pd< y` c 4      \ l , eLl [< `  "  L &  ,j( e 8Kp INH \O( oTd xc  \    T p 4d   0 /;X<G<T@cDl `  {Tp +8 , 8 P<    "D0 7 Ld  X]x kX (t   NH   Lx   4t 0  (x 7D O@t d 8 xd 4 "\4 t Yp` &YL ;[@ PZ< a+ o6h 6H AD` AB< EX H4 JD J< L<l M NPX +O >Pd QQ eS xT  U8 W Wt \\ ``L dttv< %rxt 7zD Ly ]4 o} }Xh p l  `( @, < P p (d82r` I} ]hrLi p  p TH H  , xX || h( +֬ 8 F\ ]\ tX ` 4 4 8  < , PD 4 0 T !   ! 8 !4P!@P!N !, !d !TH !y !,  ! ! ! , ! %|, ! % !! 1X ! / !! 5 " 7 " 8`, "! 8x "8 9| "G A "^"m j " hT " j " i, " gh " bx " c` " a # b, #%#1 #; #G #R k #e lHP #v# ## odh # # p # s # t # qt # u $ $ $  $ ~ $-  $:i $C $O+|$V  $a 4 $j-x$t- $- $ @ $   Ř` $-$-$-$-$-$-%-%-%-%(-%7-%K )l, %\ )L %l ) %-% *x % +L %-% +T % ,$ % , %  & (| & p< & 8 &) ,D &7 '4 &B ` &Q % &] , &t  &  & X &.\i &.\@& .p & -H & .$` & . & 0,X ' 0$ ' -hd '* /` ';.@'J 0  'W 1 'h 8  'y.@' FH ' F ' Fd ' GH ' KDh ' K ' Dl '/' 0 ( ?$ ( = (' = (8 ; (D ELp ,L Y ,T \ ,[ H ,a L ,g $L ,n pP ,v < ,~  , E , 8 , T , jd , i ,  , P , ; , P , ^$  , @ , 8P , = , < - B@ - A$ - @ H ,  - T  -( | -- AL -5 T  `` -@  -I $l -T  -Y  -b X -j \ -i 0 -r  -z CD( - hl - BtL - D< - 98 - CD  80 -  - <\ - =Ph - AxL - \ - ^p - P - a| - ` - bl . _ . Z . i4 . Y .( t .3 2 .< 7d -Q x8 .F \ .Q X .Z , ._ +, , 4 .f Y4 .o  .x (\ . L . H . ) -% $ .   . x( . *| . "| . ! . + / , / -l( / - /$ /8 /. 1` /: 2 /A 34 /L 7D( /J 7l /W <  /a =D /n >( /w B4@ / Cl / DT / EL / S  / Q / F / Jx / Tt / H / N / LP / R / ST / T0T 0 W|t . Z4 0 ]| 0 ah 0$ b(4 0;0E qlH 0K u| 0F nd 0S dL 0Z P 0c  0l wl 0t  0| r 0 vx 0k {d 0 wX 0 z 0 x 0 $ 0  0 |T 0 ~lP 0 d 0 h| 0 d 0 T 0 T -\  0  00M1N1 1 1#N11N1DO 1R81^  1m  1 d 1 lH 1 l 11P 1P @1  1 x 2 tt 2  2- ňD 2D L 2[ ( 2n  2 0 2 (( 2  2  2 ǐ0 2  2 Ȑ 2  3  3 P@ 303: 4 3C $ 3QP`3`P`3n H 3x t 1 x 3  3 ֔ 3  3 0 3  3 h 3  3  4 ژ 4 @ 4'  49 ܘ 4H  4Y @ 4p x 4 x`  08 44 PT 444  4  4 < i 44 \ 5  5 @ 5 P 5 @  5' \ 50 ($0 i 585B 8x 5V 300 5b 3`p 5p H 5x I 5 K 5 S8 4 5 ^l  i 55P5Q5Q5 L i 5 n  5 rp 6 z8X 6 {P P6  6%  64  6A x 6N p 6] px 6g ,x 6s t 6 t 6 0x 6  6 4 6i  6i  6 px 5i  6667 77)X 79 2h 7F7L ǰ 7[t 7ly 7zTd 7{ 7?X 7 2| 7 P 7+8x 7@ 77 8 @ 8 H 80 8I h 8ZW 8j L 8t, 8 8p 8 8 'L 80 8x8,l 8 L 8 @ 8qd 9  9  9-4(99  9H=  9Yp, 9h@ 9{|9 w 9r 9|9, 99 8 90 9 @ 9  :  :4:!H|:5h:;p :LH0 :d l, :kl :  :, :h: p : 48 :( :  :;P d ;  ;/;5P ;L ;b x ;m _8x ; 4 ; ;  ;P\ ;;;  ;(;pp < k8 < X$ <&0$ <7xd # >  >30>:\@>J  >Z$h >w  >f >  > , > * >]l >7 >>  ?  ?.p ?@ l ?P$?^?ft ?x?D$ ? t ?@?  ?΀P ?=  ?  ?  ? < @ x8 @#0H @9P @H4 @^@d@k\ @ pD @ 0\D @̘ @ l @  @e( @@ WH Ap A^  D A( A9  A@¤AI  AVQX8 A_ 4 Ap|D Az A- AD m  AA A \( A AXAAL A B  B 8T B%$ B7DH BI l B`X Bs|8 B  B BB Bk B 8 B( B C ( C,C"H C7  CBB CV_ Ci X, Cz 1` C ,X C X8 C | C |T C|< Co C x CX| Dd D D9x DF DZf DwRPx D H0 DDD L D.< D D44 D nP D E  E E(\E-  E8 <0 EP0h  E] |8 EnXEw E EE  E  E o4 E  E X4\ E F -  F n  F/P FFjPh FY  Ff-xFx / FF  FH F-|F FF|F GK( G\ G < G,x G;| GJ, Gf X` G~G  G 4 G l4 G GG)x, Gp G H qd H H H( x H8 @ HHHT- Hc 8 Hw  H?p HlH H=P H|( H` H H\ I <  I"ь I,,@ I7 ` IB  IP( Ib( IoLIv I ĔH IIX I@ I | I ڄ I  J8 J T J" mt4 J7JB\ JQ !,D JY( Jlk JJp Jhp Ju J$\ Jt, J | J 0 J$ HK$  K& K4  KK 0 KRpK[ Kc$8 KotKv4x K3 K;L@ K  K Kd K  K  Ld L Lkp L1L;d LI 0 LX CPt LdLn LT LkP L0 L _4 L xX Li< L $$ M v Mpx M1ǬP MB MO(4 Mc< Mw ܐL M  Mw  M  8  M k D MXM "` MTXN o N 5 N+ N9N> NOÈN^md Ni= N~NN38 N  N NN ( N8 N  N  O,p Oz 9| O*3t O;   OH X| O^? OkO{ O /d O  O S<4 O   Ok( O O xp P P P1$ PI PU  Pa ( Po @ P-P  K\ !P P PXt P V P!\ Q H :hQ Q#4Q) Q8k QQh Qe ̜ Qv  Q Q L Q H Q !` Q  Q< Q 4< Q$ +QR U0 R d R1R=L,4  RD 8 RY?p Ro4 RtD R *p RpRRk R  Rx R40 S dD S *d  S'S. ` S:h SKDSSl Sod ?V>\l S~ h S S |H S @ S48 S  S  S  Tp Th T#gL T3  TKTW Tl ( @ TtT T? T ` TTtTl4 T T( U  UT U0U8U?t UQ8 Uhlx Ur, U \ UU f U t UUj UU x UU Ux Vcl V(@ V+V0V7fd VK - 4 V`!L VqҬ V{  V\V; ,,V V | V, V,L V `  VP Wh ! , WW*z  W;h WHWW0` Wf  Ws` W~i4< W 0 W  W 0D W(l W 0L W(T W)`T X ߠ X?  X \ X,<X< | XIi X^dXbDT NX~L X"XX o X T X( XX| Y  Y i|L Y& ` Y4 DD0 YCD YMx , YR, Y^  Yjt( Y  Y  Y`< YLj Y@YYˠ  Y , ZZ l Z  Z2' Z?h ZV , Z` Zj L Zxt Z rX ZgH Z)$ ZTZD, Z  Z([  [L [#$ [/ T [@ `  [O( []  [p g<, [[ <  X [  [, [[  [ ] \P\  \hp \&5h \; p  \LL \] mDd \f ^ \v   \~# \ \.\Ӝx \  \ \| ]  ] p ]1D]:J$ ]RTD ]axh ]v x ]}( ]at ]l ( ] ]], ]T ^  ^d ^(  ^98 ^Jp ^\^e ^r  ^ ` ^ h ^5  ^M ^. ^  ^ Qp _ | _  _ $ _, Ĩ _=D _O _^  _m 3 _"X$ __Q< _X, _D' _$ _ O _p _  `lH( `%à!`-( `<`C ( `T o `fjL `v \X ` <$ `x ` `  ( ` h `)l `  a , a l4 a.~h aA jh aK x aVˆaZ=Lh ahT a aTt a  a¼a E< aG0 a a a8` b T 9bx b+b14b8  bH@ b_ Ud  brbw  b Ll b  bb , b<P b(b  b cJ cc m4 c6c<t X]cK }D c^ , cr ޠ cc sX cc Wh c $ cc\ c t cc X d (d!kt d3dAp dS$t d\dcdk  d| d8 d4 d 1  d + d5| d d4< eeh e&x eAeI \ eZT ep  e}$ e>  ee ( e/( N<P e < e|e D e4$ f l f"0 f5L fEx  fZ ) fk4( f~L fJ` f` f  f 4 8 fj@ f *f\t f\ g40 g g#  g; & gM g[ga gu2,  g g x0 gĜ g` g W gD g0p g g; h̐ h u h1\d h:hFxhKGp h^he7L hz % hh@h hk hΨD hThF| hd hL hi( i 8 i&  i7 l4 biG0( i[ iedimivML i )Tt iJP in| i i5r ބ i 4\ ip i $ i X i j k  j# |  j/ 3`, j@h jR,jZX@ jp T aUjp jjj @ j  jR$ j? j  jH k (  kd4 k# k4ͬ kDh4, kZl0 kh  ky C$ kϐ  kkkh k P k ', kl k(, k|l <( l'\4x l7l lA  `$àlSp ldT lt H8 ll lH l U l  lr l ., llm . mh m/lm6  mG  mT ( m] ms  m mt mxh m m m 0L m *8 m @ mn \ nm n/ | n>а nF  nZ nl d ns>  n H8 nlT nnp nIPd nHnw  n 8 o`  od o1$( o= l oT ob ,1K ouv4 /ot` Y\ o op<X o  o  o ooP p  p \X p"p1  p? B( pJ p_fp pn\@ p~x pl pp\ \ p t p d< p Xd p L q8 q< q-  q=  qK  qc$qh x q{8 qcp8 q q, q | qk( q ' rPp r%8 r" $ r/r6 | rNox r`qH  rt( rL< r | r,  r, r |( rl r r#  s  sH  s(,@ s=| sOO s_  sppszPD s0s  s ( s5  s>\ 4  @ sxH sjd< sT t  t  t-t5 m@T tJP t[ to l  t~! ttPx tL t|  tCH t(t tG u|| u`u" u2d uE uV xDd ufd @ ur0, u  u H  uHp u 3L u YH ugh0 uM( R kH v L v p v(8 v6 vHX vE vQ\vX  !vl h v}  v8v  v( v3(L v  v vv 0 v w w ( w" w/  wA  wP "p wXi V*wm P  L w  www8 w w wx wPw x@ x   x1x6  xF3 xWx^ ( xp xlL  xx $X xh xE'tx8 x n Mـx | y  y  y.kP ?wyD8 NلyV(0 yn yĐ yyR"P y y , y ` yP H yH z  zz z- z4z:D zDk z] | zkzr  z( z A zl@ zD$Lz H z"|  zz4T cHz T { m04 { {(8 {<d {S{Y D  {b, {lvl {x {%h { &P { L {z {` { k` {{ \ |?@ | Z8 |$|+l|l |6 PX |I|U  |`( |rhx | kx |j0 |( |oHt | | | x  |ì| } g$ } }" 2 8 / D }.LT }:x }L }d|  }v, }͸ }10 }  }8 l`} Έ< } ` } l }L}$h4 ~~ m ~ t ~44 ~C? ~Sx~X<~]\ ~nE ~ 0@ ~~Pd ~ \| ~X~l~\ ~h0 ~s,  8h l  !\ 3< GQ Hh a 4 m8 ~Pl  ,$ P$  $  | x  Ș  H \50x (  ; 8  N m| d d xtd(8 < \   4 ^4X  @ n, <p "8 7M 0 J< Y8T kt ”L,  X 8   (\ 0  _ )vh 8 X< Hl [Dt l oL | [ _hD èinstallkit_barecrti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatacrapvfs.cBbss.bssDdata.dataCrapvfsAttrscrapvfsFilesystemNativePathInFilesystemTclNativeDupInternalRepNativeFreeInternalRepTclFSInternalToNormalizedTclpFilesystemPathTypeNativeFilesystemSeparatorTcl_StatTcl_AccessTcl_OpenFileChannelTclpMatchInDirectoryTcl_FSListVolumestclpFileAttrStringsTcl_FSFileAttrsGetTcl_FSFileAttrsSetTcl_ChdirvfsChannelTypeDriverCloseDriverInputDriverOutputDriverSeekDriverWatchDriverGetHandlelocalStrDupCanonicalPathTclFSNormalizeAbsolutePathAddPathToArchiveCrapvfsLookupGetCrapvfsFileCrapvfsFileMatchesTypeDriverExit___const_seg_900002901MountObjCmdUnmountObjCmdSetPasswordObjCmdminiarc.crc4_typeMiniarc_PathIsInVFSMiniarc_ReadMiniarc_WriteMiniarcGzipObjCmdMiniarcGunzipObjCmdCopyOctal___const_seg_900001401MiniarcTarAddFileObjCmdGetZipDateSetByte___const_seg_900001701MiniarcZipAddFileObjCmd___const_seg_900001801MiniarcCrapAddNoneObjCmd___const_seg_900001901MiniarcCrapAddZlibObjCmdMiniarcCrapCryptFileObjCmdsha1.citoa64fnumcontextssha1ContextsctxtotalRead___const_seg_900000502Sha1_CmdLZMADecode.c___const_seg_900000301installkit.cLibraryPathObjCmdLoadMiniarcObjCmdmain.cargv0zlib.c___const_seg_900000105zvfs.cZvfsAttrszvfsFilesystemDosTimeDateZvfsLookupGetZvfsFileZvfsFileMatchesType___const_seg_900003001tclXcmds.cTclX_SystemObjCmdtclXutil.cERRORINFOERRORCODEParseTranslationOptionFormatTranslationOptiontclXunixId.cconfNGroupsUseridToUsernameResultUsernameToUseridResultGroupidToGroupnameResultGroupnameToGroupidResultIdConvertIdEffectiveIdProcessIdGroupidsIdHostGetSetWrongArgsIdUserIdUserIdIdGroupIdGroupIdTclX_IdObjCmdtclXunixOS.ctclBasic.cbuiltInCmdsDeleteInterpProcCallCommandTracesProcessUnexpectedResult___const_seg_900004701___const_seg_900005001StringTraceProcStringTraceDeleteProctclBinary.cFreeByteArrayInternalRepDupByteArrayInternalRepUpdateStringOfByteArraySetByteArrayFromAny___const_seg_900001002GetFormatSpecFormatNumberDeleteScanNumberCacheScanNumber___const_seg_900001501CopyNumbertclCkalloc.ctclClock.cFormatClocktclCmdAH.c___const_seg_900001202GetStatBufCheckAccessStoreStatDataGetTypeFromModetclCmdIL.cInfoArgsCmdInfoBodyCmdInfoCmdCountCmdInfoCommandsCmdInfoCompleteCmdInfoDefaultCmdInfoExistsCmdInfoFunctionsCmdInfoGlobalsCmdInfoHostnameCmdInfoLevelCmdInfoLibraryCmdInfoLoadedCmdInfoLocalsCmdInfoNameOfExecutableCmdInfoPatchLevelCmdInfoProcsCmdInfoScriptCmdInfoSharedlibCmdInfoTclVersionCmdInfoVarsCmdAppendLocals___const_seg_900003501DictionaryCompare___const_seg_900003901MergeSortMergeListsSortComparetclCmdMZ.ctraceSubCmds___const_seg_900000401___const_seg_900000906___const_seg_900001601TraceVarProcTraceCommandProcTraceExecutionProcCallTraceProcedureCommandObjTraceDeletedtclCompCmds.cDupForeachInfoFreeForeachInfoTclPushVarName___const_seg_900002001tclCompile.cFreeByteCodeInternalRepDupByteCodeInternalRepTclSetByteCodeFromAnyauxDataTypeTableInitializedauxDataTypeTableEnterCmdStartDataEnterCmdExtentDataLogCompilationInfoGetCmdLocEncodingSizeEncodeCmdLocMap___const_seg_900003601tclDate.cTclDatemaxdepthMonthDayTableUnitsTableOtherTableTimezoneTableMilitaryTableTclDateexcaTclDatepactTclDater2TclDatedefTclDateRelPointerTclDateRelDayTclDateRelMonthTclDateMeridianTclDateYearTclDateMonthTclDateDayTclDateTimezoneTclDateHaveZoneTclDateHaveTimeTclDateHaveRelTclDateHaveOrdinalMonthTclDateHaveDayTclDateHaveDateTclDateDayNumberTclDateDSTmodeTclDateInputTclDateerrorToSecondsDSTcorrectNamedDayNamedMonthRelativeMonthRelativeDayLookupWordTclDatelex___const_seg_900001301tclEncoding.cencodingsInitializedEncodingTypeFreeEncodingIntRepDupEncodingIntRepemptyPagesystemEncodingdefaultEncodingencodingTableBinaryProcUtfExtToUtfIntProcUtfIntToUtfExtProcUnicodeToUtfProcUtfToUnicodeProcTcl_FreeEncodingLoadEncodingFileunilenTclFindEncodingsOpenEncodingFileLoadTableEncodingLoadEscapeEncodingTableToUtfProcTableFromUtfProcTableFreeProcEscapeToUtfProcEscapeFromUtfProcEscapeFreeProcUtfToUtfProcGetTableEncodingtclEnv.ccacheSizeenvironCacheourEnvironEnvTraceProcReplaceStringtclEvent.cfirstExitPtrinFinalizetclLibraryPathStrdataKeyBgErrorDeleteProcHandleBgErrorsVwaitVarProctclExecute.cexecInitializedoperatorStringsExprUnaryFuncExprBinaryFuncExprAbsFuncExprDoubleFuncExprIntFuncExprRandFuncExprRoundFuncExprSrandFuncExprWideFuncInitByteCodeExecutionGrowEvaluationStackTclExecuteByteCode___const_seg_900000909GetSrcInfoForPcIllegalExprOperandTypeExprCallMathFuncGetExceptRangeForPcVerifyExprObjType___const_seg_900002101___const_seg_900002201___const_seg_900002401___const_seg_900002501___const_seg_900002601___const_seg_900002701___const_seg_900002902tclFCmd.cFileCopyRenameFileForceOptionCopyRenameOneFileFileBasenametclFileName.cFileNameInitFileNameCleanupExtractWinRootSplitUnixPathSplitWinPathSplitMacPathDoTildeSubstSkipToChartclGet.c___const_seg_900000302tclHash.cHashArrayKeyCompareArrayKeysAllocArrayEntryHashStringKeyCompareStringKeysAllocStringEntryRebuildTableBogusFindBogusCreate___const_seg_900000901tclIndexObj.cFreeIndexDupIndexUpdateStringOfIndexSetIndexFromAnytclInterp.caliasCounterInterpInfoDeleteProc___const_seg_900000303GetInterpAliasDescribeAliasDeleteAliasCreateGetInterp2AliasListSlaveCreateSlaveEvalSlaveExposeSlaveHideSlaveHiddenSlaveInvokeHiddenSlaveMarkTrustedSlaveRecursionLimitAliasObjCmdAliasObjCmdDeleteProcSlaveObjCmdSlaveObjCmdDeleteProc___const_seg_900002301tclIO.cGetChannelTableDeleteChannelTableCheckForStdChannelsBeingClosedTcl_DetachChannelCleanupChannelHandlersDiscardInputQueuedUpdateInterestAllocChannelBufferRecycleBufferDiscardOutputQueuedCheckForDeadChannelFlushChannelCloseChannelCheckChannelErrorsDoWriteCharsStopCopyDoWriteWriteBytesTranslateOutputEOLCheckFlushFilterInputBytesPeekAheadCommonGetsCleanupGetInputStackSetBlockModeDoReadCopyBufferDoReadCharsReadBytesTranslateInputEOLHaveVersionChannelTimerProcDeleteScriptRecordCreateScriptRecordCopyDataCopyEventProcCopyAndTranslateBuffertclIOCmd.cTcpAcceptCallbacksDeleteProcRegisterTcpServerInterpCleanupUnregisterTcpServerInterpCleanupProcAcceptCallbackProcTcpServerCloseProctclIOSock.ctclIOUtil.cstatProcListaccessProcListopenFileChannelProcListNativeCreateNativeRepNativeFileAttrStringsNativeFileAttrsGetNativeFileAttrsSetnativeFilesystemRecordfilesystemListcwdPathPtrtclFsPathTypeFreeFsPathInternalRepDupFsPathInternalRepUpdateStringOfFsPathSetFsPathFromAnyFsThrExitProcFsGetFirstFilesystemFsUpdateCwdFsAddMountsToGlobResultFsListMountsFSUnloadTempFileTcl_FSGetPathTypeFindSplitPostclListObj.cFreeListInternalRepDupListInternalRepUpdateStringOfListSetListFromAnytclLiteral.cHashStringAddLocalLiteralEntryRebuildLiteralTableExpandLocalLiteralArraytclLoad.cfirstPackagePtrLoadCleanupProctclMain.ctclStartupScriptPathmainLoopProcPromptStdinProctclNamesp.cnumNsCreatedFreeNsNameInternalRepDupNsNameInternalRepUpdateStringOfNsNameSetNsNameFromAnyNamespaceFreeDeleteImportedCmdInvokeImportedCmdGetNamespaceFromObjNamespaceChildrenCmdNamespaceCodeCmdNamespaceCurrentCmdNamespaceDeleteCmdNamespaceEvalCmdNamespaceExistsCmdNamespaceExportCmdNamespaceForgetCmdNamespaceImportCmdNamespaceInscopeCmdNamespaceOriginCmdNamespaceParentCmdNamespaceQualifiersCmdNamespaceTailCmdNamespaceWhichCmdtclNotify.cfirstNotifierPtrTcl_QueueEventtclObj.ctypeTableInitializedUpdateStringOfBooleanSetBooleanFromAnyUpdateStringOfDoubleSetDoubleFromAnyUpdateStringOfIntSetIntFromAnyUpdateStringOfWideIntSetWideIntFromAnyHashObjKeyCompareObjKeysAllocObjEntryFreeObjEntrytclCmdNameTypeFreeCmdNameInternalRepDupCmdNameInternalRepSetCmdNameFromAnytypeTable___const_seg_900001902SetIntOrWideFromAnytclPanic.cpanicProcplatformPanicProctclParse.ccharTypeTableParseCommentParseTokensTcl_CommandCompletetclPipe.cdetListFileForRedirecttclPkg.cFindPackageComparePkgVersions___const_seg_900000801CheckVersiontclPosixStr.c___const_seg_900000101___const_seg_900000402___const_seg_900000701tclPreserve.cspaceAvlinUserefArraytclProc.cProcBodyFreeProcBodyDupProcBodyUpdateStringProcBodySetFromAnyTclCompileNoOpTclProcCompileProcProcessProcResultCodetclRegexp.ctclRegexpTypeFreeRegexpInternalRepDupRegexpInternalRepSetRegexpFromAnyCompileRegexpRegExpExecUniCharFreeRegexpFinalizeRegexptclResult.cResetObjResultSetupAppendBuffertclScan.cBuildCharSetCharInSetReleaseCharSet___const_seg_900000403ValidateFormat___const_seg_900000603tclStringObj.cFreeStringInternalRepDupStringInternalRepUpdateStringOfStringSetStringFromAnyFillUnicodeRepAppendUtfToUnicodeRepAppendUtfToUtfRepAppendUnicodeToUnicodeRepAppendUnicodeToUtfReptclThread.ckeyRecordmutexRecordcondRecordRememberSyncObjectForgetSyncObjecttclStubInit.ctclStubHookstclStubLib.cHasStubSupporttclTimer.cInitTimerTimerSetupProcTimerCheckProcTimerExitProcTimerHandlerEventProcAfterCleanupProcAfterProcGetAfterEventFreeAfterPtrtclUtf.cgroupMapgetgroupstotalBytesUtfCounttclUtil.cprecisionStringprecisionFormatUpdateStringOfEndOffsetSetEndOffsetFromAnytclVar.cnoSuchVarisArrayneedArraynoSuchElementdanglingElementdanglingVarbadNamespacemissingNameisArrayElementtclLocalVarNameTypeFreeLocalVarNameDupLocalVarNameUpdateLocalVarNametclNsVarNameTypeFreeNsVarNameDupNsVarNametclParsedVarNameTypeFreeParsedVarNameDupParsedVarNameUpdateParsedVarNameSetArraySearchObjVarErrMsgNewVarDeleteSearchesCallVarTracesCleanupVarUnsetVarStructDeleteArray___const_seg_900003101ParseSearchIdObjMakeUpvarDisposeTraceResulttclUnixChan.cfileChannelTypeFileCloseProcFileInputProcFileOutputProcFileSeekProcFileWatchProcFileGetHandleProcFileBlockModeProcFileWideSeekProcttyChannelTypeTtyCloseProcTtySetOptionProcTtyGetOptionProctcpChannelTypeTcpCloseProcTcpInputProcTcpOutputProcTcpGetOptionProcTcpWatchProcTcpGetHandleProcTcpBlockModeProcspeedsTtyModemStatusStrTtyParseModeTtySetAttributesTtyGetAttributesTtyGetSpeedTtyGetBaudTtyInitMakeTcpClientChannelModeWaitForConnectCreateSocketCreateSocketAddressTcpAccepttclUnixEvent.ctclUnixFCmd.cGetGroupAttributeSetGroupAttributeGetOwnerAttributeSetOwnerAttributeGetPermissionsAttributeSetPermissionsAttributeDoRenameFileDoCopyFileCopyFileAttsDoCreateDirectoryTraverseUnixTreeTraversalCopyDoRemoveDirectoryTraversalDeleteGetModeFromPermStringtclUnixFile.cNativeMatchTypetclUnixPipe.cpipeChannelTypePipeCloseProcPipeInputProcPipeOutputProcPipeWatchProcPipeGetHandleProcPipeBlockModeProcSetupStdFileRestoreSignalstclUnixSock.chostnameInitedgethostnametclUnixTime.clastTZtmKeySetTZIfNecessaryCleanupMemorytclUnixInit.cinitScripttclPreInitScriptlibraryPathEncodingFixeddefaultLibraryDirpkgPathlocaleTabletclUnixThrd.ctclUnixCompat.ctclUnixNotfy.cFileHandlerEventProctclLoadDl.cregcomp.cfunctionsrfreebackDbrbackdbackwcnamesfreevinitcmnewnfanewcvecnmccesnleadersallmccesaddmccelexstartnewlinesubcolorokcolorsTclDateparsespecialcolorsdumpnfadumpstoptstnumstmarkstcleanstnfatreenfanodeoptimizemakesearchcompactstrcasecmpstrcmpstdumpmoresubsfreenfafreesubrefreecvecfreelaconsrainbownewarcnewstatecopyoutscparcfreearcparsebranchbrenextmoveinsparseqatomwordchrsnonwordlexwordnewlacononechrcbracketscannumdelsubrepeatmoveoutsdupnfacolorcomplementcloneoutsbrackpartdropstatefreestatefindarchaschrelementscanplaineclassdoveccclassaddrangeaddchrallcasesclearcvecnextleadersubrangesingletonfreesrnodefreecnfastidfreecmdumpcnfaprefixes___const_seg_900004001lexnest___const_seg_900004301skiplexescape___const_seg_900004601chrnamedlexdigits___const_seg_900004801cmtreefreesetcolormaxcolornewcolorfreecolorpseudocolornewsubsubblockuncolorchainnewfstatedestroystateallocarccopyinsdeltraverseduptraversecleartraversecleanupfixemptiespullbackpushfwdanalyzepullcrc32_combinepushunemptymarkreachablemarkcanreachcarcsortgetcvecbefore___const_seg_900012601regexec.ccfindzapsubsnewdfashortestfreedfacdissectlongestcfindloopzapmemsubsetcaltdissectccondissectcbrdissectcrevdissectinitializemisslastcoldhashgetvacantpickssregfree.cregerror.crerrstclAlloc.ctclAsync.ctclCompExpr.copTableInitializedoperatorTableopHashTableCompileSubExprCompileMathFuncCallCompileLandOrLorExprCompileCondExprLogSyntaxErrortclHistory.ctclIOGT.ctransformChannelTypeTransformCloseProcTransformInputProcTransformOutputProcTransformSeekProcTransformSetOptionProcTransformGetOptionProcTransformWatchProcTransformGetFileHandleProcTransformBlockModeProcTransformNotifyProcTransformWideSeekProcResultInitResultClearExecuteCallbackResultAddResultCopyResultLengthTransformChannelHandlerTimertclLink.cObjValueLinkTraceProctclParseExpr.clexemeStringsGetLexemeParseCondExprParseLorExprParseLandExprPrependSubExprTokensParseBitOrExprParseBitXorExprParseBitAndExprParseEqualityExprParseRelationalExprParseShiftExprParseAddExprParseMultiplyExprParseUnaryExprParsePrimaryExpr___const_seg_900001402___const_seg_900001602ParseMaxDoubleLengthtclResolve.cBumpCmdRefEpochsadler32.ccrc32.cget_crc_tablecrc32_littlecrc32_biggzio.cgz_opengz_magicget_bytecheck_headerdestroydo_flushputLongdeflate.cconfiguration_tableputShortMSBflush_pendinglm_initlongest_matchdeflate_storeddeflate_fastdeflate_slowinftrees.cstatic_l_descstatic_d_descstatic_bl_descextra_blbitsgen_bitlenbuild_treescan_treesend_treebl_ordersend_all_treesstatic_ltreestatic_dtreecompress_blockbase_distextra_dbitsbase_lengthextra_lbitsset_data_typebi_windupcopy_blockzutil.cinflate.c___const_seg_900000501inffast.ccompress.ccrtn.s_END__START_Tcl_ExprBooleantclStubsPtrTclFinalizeAuxDataTypeTabledeflateBoundatan2TclpFindSymbolTcl_FSRenameFileTcl_EofObjCmdTclGetLongTcl_JoinPathTcl_DumpActiveMemoryTcl_SetErrorCodeVATcl_MakeTcpClientChannelTcl_FlushTcl_SetStdChannelstrncpyTcl_InitHashTableTcl_FSFileAttrStringsTclpMasterUnlockTclX_SaveResultErrorInfoTcl_GlobalObjCmdTcl_WhileObjCmdTclInvokeTcl_GlobalEvalTcl_FcopyObjCmdTclSetStartupScriptPathswapgzeofrc4_inittclFreeObjListTclFinalizeLoadTcl_DStringGetResultgzdopenTcl_GetBooleanFromObjTcl_PanicVATcl_DeleteTracetclIntStubsTclpGetSecondsTcl_AttemptAllocTcl_ListObjCmdTcl_ExprBooleanObjsqrtTclServiceIdleTcl_UtfToExternalgetgrnamTcl_GetWideIntFromObjutimeTcl_UniCharIsDigitTclCompileLappendCmdTcl_WaitPidTcl_UniCharIsUpperTclpGetDatestrncmptclNativeFilesystemioctlTclRenameCommandTcl_GetByteArrayFromObjgzgetcTcl_ReapDetachedProcsTcl_UniCharIsSpaceTclCompileWhileCmdfwriteTclpCreateCommandChannelTcl_AsyncReadyTcl_SwitchObjCmdTcl_UniCharNcmpgetpwuidTclChannelEventScriptInvokerTclpGetHostByNameumaskTcl_EvalTokensStandardTclSockMinimumBuffersTclpGetCwdTcl_AppendUnicodeToObjgzgetsTclInitCompileEnvTcl_ConvertCountedElementSha1_InittclStringHashKeyTypestrftimeTcl_SplitObjCmdacceptTcl_CreateObjTraceTcl_ChannelInputProczcallocTcl_FSEqualPathsTclFinalizePreserveZvfs_SafeInitTclCleanupChildrenTcl_UpvarObjCmdTcl_ListObjAppendElementTcl_FSFileSystemInfoTcl_GetCwdTcl_GetAssocDataTcl_ReadTcl_ConcatObjTclCompileSetCmdTclGetDateSHA1UpdateTcl_EvalObjCmdTcl_FirstHashEntryinflatePrime_etextgetpidTcl_FSRemoveDirectorytclIntPlatStubsPtrTclXOSsystemgetuiddlsymTcl_SetIntObjgzreadTcl_SetLongObj.st_float_foreffTcl_DeleteEventsTcl_FlushObjCmdgzclose_finiTcl_ExitObjCmdTcl_SetDoubleObjTcl_GetGlobalNamespaceTclpFinalizeSocketsaccesstclIntPlatStubsTcl_ScanElementTclOpenFileChannelInsertProcTclIncrVar2Tcl_GetChannelNamesExTclUnsetEnvTclGetObjInterpProcTcl_GetObjResultTcl_SetNotifierTclGetNamespaceForQualNamesysconfTclFSMakePathFromNormalizedTcl_UniCharIsControlTclFreeCompileEnvTcl_AsyncDeletechownTcl_DbCkreallocTcl_ParseVarNamevsnprintfTclX_StrToUnsignedTcl_UniCharIsLowerlogTcl_UtfToLowerTclPreventAliasLoopTcl_AttemptDbCkallocTclpFindVariablegzputcTcl_UplevelObjCmdTclFSCwdPointerEqualsTcl_CreateExitHandlerTclGetOpenModeTcl_UnregisterChannelfseekstrlenTclFinalizeNotifierTclpFindExecutabledeflateSetHeaderTcl_GetAliasgzsetparamsTcl_RegExpGetInfoTclInitEncodingSubsystemTclDatestateTcl_GetUnicodeTcl_GetsObjCmdTcl_DeleteEventSourceTcl_WrongNumArgsgzputs_DYNAMIC_length_codelzmaInitTclpInitPlatformZlib_Init.ld_doubleTcl_SeekTclX_GetOpenChannel_PROCEDURE_LINKAGE_TABLE_.st_floatTclpObjStatTclParseHexrealpathgetpgrpTcl_ExitTclInitSubsystemsTclpOpenFileTcl_BackslashTcl_PushCallFrameTcl_ListMathFuncsTclpObjCreateDirectoryTcl_LreplaceObjCmdTcl_FSMatchInDirectoryTclpUtfNcmp2Tcl_SetErrnomallocTcl_SocketObjCmdTcl_ChannelCloseProcTcl_AddInterpResolversTcl_GetCommandInfoTclParseWhiteSpaceTclpObjAccessabortTclCompileLlengthCmdTcl_ConcatTcl_NamespaceObjCmdTclCompileBreakCmdTclGetInterpProcTcl_ResetResultTclMatchIsTrivialTcl_InitNotifierTclCompileExprTclPtrSetVarTclResetFilesystemTcl_GetStringFromObjinflateInit2_TclInitByteCodeObjTcl_GetIntTcl_DeleteThreadExitHandlerTclX_UpShiftTcl_NewByteArrayObjTclFinalizeEncodingSubsystemTclCopyChannelTcl_RegExpMatchunameceilTcl_LinkVarTcl_AppendExportListTclDoGlobTcl_OutputBufferedTclFinalizeSynchronizationTclLsetListTcl_TraceVar2Tcl_DbIncrRefCountfreadTcl_UpVar2Tcl_GetNameOfExecutabletclIndexTypeTclFinalizeAsyncendpwentTclX_GetOpenChannelObjrc4_from_anymodfTcl_ConvertElementTcl_SetVar2ExTcl_MutexLockTcl_UpdateLinkedVarTcl_GetUnicodeFromObjTclFSEnsureEpochOkTclPrintInstructionTcl_ExitThreadTclFinalizeEnvironmentTclFinalizeObjectsTclpInetNtoatclExecutableNameinflate_copyrightTclDatetmpTcl_CreateMathFuncTcl_GetVersiontclNativeExecutableNameTclSetCmdNameObjsockettclEmptyStringTcl_EvalObjvTcl_CdObjCmdTclCreateProcTclpGetClicksTcl_FSLoadFileTcl_ProcObjCmdTcl_GetCommandInfoFromTokenTcl_DStringStartSublist__huge_valTcl_UnsetVarTclObjInvokeGlobalTcl_MutexFinalizeTcl_DeleteExitHandlerrecvSHA1TransformTcl_CreateHashEntryTcl_CreateAliasObjTcl_SetBooleanObjTclpGmtimeTcl_RegExpRangeTclLooksLikeIntcfgetospeedTcl_TimeObjCmdTclSetPreInitScriptTclLookupSimpleVarTclResetShadowedCmdRefstclByteCodeTypeTcl_PkgRequireProcTcl_ReallocTclSetEnvTcl_DbNewWideIntObjTcl_PkgRequireTcl_NextHashEntryTclpGetHostByAddr.ld_floatTcl_FSLinkTclReErrorTcl_EvalObjExTclReleaseLiteralTcl_PreserverenameTcl_SetByteArrayLengthinflateGetHeadertclListTypeTcl_SetRecursionLimitTcl_PkgProvideExzcfreeTclLookupArrayElementTclpCreateProcessTcl_FSUtimeTclX_SetChannelOptionTclRememberConditionTclDatevalTclCompEvalObjgzflushTcl_DbDecrRefCountTcl_ChannelWatchProclocaltimeTcl_PwdObjCmdTclX_StrToOffsetInstallkit_InitTclFixupForwardJumpTclCompileForeachCmdTcl_SetVar2Tcl_UtfToTitletclInstructionTableTcl_GetMathFuncInfoCrapvfs_MountTcl_ScanCountedElementzErrorendgrent__ctyperc4_dup_repstrcatTcl_WriteRawTcl_InputBufferedTclTraceCommandObjCmdTclHideLiteralTcl_GetInterpPathTcl_GetLongFromObjTclObjLookupVarTcl_GetInterpResolversTcl_ParseBracesgetgidTclpNativeSplitPathTclDatepsTcl_SignalMsgTclpMasterLockdeflateCopyTclDatepvTclFreePackageInfoTclFSSetPathDetailsTcl_GetObjTypeTclCompileCmdWordTcl_AppendObjToObjTcl_RegExpExecObjTcl_IsChannelExistingTclUpdateReturnInfoTcl_CancelIdleCallTcl_UtfToExternalDStringTcl_DeleteInterpTcl_FinalizeTcl_DeleteNamespaceTcl_FSPathSeparatorTcl_GetVar2inflateSetDictionaryTcl_DbNewDoubleObjTcl_ReturnObjCmdTcl_GetThreadDataTclDate_TclDatesTclDeleteCompiledLocalVarsTclDate_TclDatevTcl_InitStubsdeflate_copyrighttclNsNameTypecoshTcl_AddErrorInfo__environ_lockTclFreeObjTcl_FindNamespaceVargethostbyaddr___errnoTclPrintObjectTcl_FinalizeNotifier.ld_llongTclpObjChdiracosTcl_DbNewByteArrayObjTcl_FSConvertToPathTypeTcl_FSGetTranslatedPathTcl_ExecObjCmdTcl_InputBlockedTclpGetGrGidTcl_UniCharIsWordCharTcl_DbCkfreetclPlatStubsPtrTcl_CreateInterpdeflateResetTcl_GetCurrentThreadTclpGetDefaultStdChannelTcl_SplitListTcl_ChannelFlushProcTclRegisterLiteralinflateEndTclHandleCreateTcl_ClearChannelHandlersTcl_FSGetNormalizedPathTcl_EvalObjinflateSyncTcl_SetResultTclParseIntegertclEndOffsetTypeTclNeedSpaceTcl_GetStackedChannelTcl_FSGetInternalRepTcl_FSCopyFileTcl_GetCharLengthTclExpandJumpFixupArrayTclpObjGetCwdTcl_AllowExceptionshypotTcl_DbIsSharedTcl_ChannelSetOptionProcTcl_DeleteAssocDataTclCheckBadOctalTcl_AlertNotifierTclCompileLsetCmdTclGetIntForIndexTcl_UniCharLengzseekcompressTclCrossFilesystemCopyinflateInit_Tcl_IncrObjCmdgethostbynameTcl_NewUnicodeObjTclProcCleanupProcnl_langinfostrchrTcl_UniCharCaseMatchTcl_ValidateAllMemoryTcl_DeleteHashTableTclInThreadExit_$c1A.deflateInit2_sinhsetsockoptTcl_ChannelGetOptionProcTcl_RemoveInterpResolversTcl_LinsertObjCmdTcl_SetMainLoopTclDeleteVarsdeflateInit_execvpTclRegErrorTcl_RenameObjCmddlcloseTcl_SetCommandInfoFromTokenTcl_DoOneEventTclpTempFileNameTcl_ParseCommandinflateSyncPointTcl_RegExpMatchObjTcl_LsortObjCmdTclpThreadCreateTcl_InterpObjCmdTclFindElementTcl_GetDoubleTcl_GetEncodingTcl_GetPathTypeTclpSetInitialEncodingscfsetispeedTclX_AppendObjResultgzerrorTcl_InfoObjCmdTclFinalizeMemorySubsystemTclpReadlinktheFilesystemEpochtclByteArrayTypeTclX_GetOffsetFromObjTclInvokeObjectCommandTcl_CallWhenDeletedTcl_UtfNcmpTclExpandTokenArraygeteuidmktimeTclCompileListCmdTclpNativeToNormalizedZvfs_InitTcl_FreeParse_tr_tallygetpeernameTcl_Sleepgzprintf_endTclCompileContinueCmdstrpbrkTcl_UniCharIsPunctopen64Tcl_ExprLongTcl_MakeSafeTcl_SetServiceModeTclRegisterAuxDataType_exitmkfifoTcl_GetChannelNamesdeflateSetDictionaryTclCreateAuxData.st_llongTcl_RecordAndEvalftellTcl_FindNamespaceTcl_FSOpenFileChannelTcl_GetVarTcl_CreateThreadTcl_CreateSlaveTclpReallocTcl_FileEventObjCmdTclAccessInsertProcTclDateerrflagTcl_FormatObjCmdCrapvfs_InittclWideIntTypeTclX_WrongArgsTclpObjLstatTcl_EvalExTcl_GetEncodingNameTcl_PidObjCmdTcl_GetVar2ExTcl_VariableObjCmdTclGetAuxDataTypeadler32Tcl_SourceObjCmdTclInitAuxDataTypeTableTcl_SetObjCmdTcl_FreeTcl_UtfBackslashtclProcBodyTypeinflateResetTcl_IsChannelSharedasinTcl_CreateThreadExitHandlerTclFinalizeIOSubsystem_get_exit_frame_monitorconnectTcl_ConditionNotifyTcl_UniCharToUpperTclX_InitCommandsTcl_LsearchObjCmdTclObjCommandCompleteTclpObjCopyFileTcl_ParseExprTcl_ScanObjCmdSHA1FinalmainTcl_VarEvalTclpObjLinkTclGetStartupScriptFileNameTclpGetPwNamTcl_DeleteFileHandlerTcl_CreateChannelTcl_InterpDeletedstrcpygetservbynameTcl_PackageObjCmdTclpCloseFilegettimeofdaycompressBoundTcl_DStringSetLengthMiniarc_InitTcl_DeleteCloseHandlercompress2rc4_cryptTclpLocaltimeTclAddLiteralObjTcl_CreateTimerHandlerTcl_SetDefaultEncodingDirTclTeardownNamespacewaitpidTcl_DeleteCommandFromTokenzlibVersionfmodTclCreateExceptRangeTcl_FSDataTclX_IdInitTcl_NewStringObjTclpUnloadFileTclX_JoinPathTcl_UniCharToTitleTcl_AppendStringsToObj__fsr_init_valueTcl_UtfToUniCharTcl_UnsetObjCmdTcl_CreateCloseHandlergetsocknameTclInvokeStringCommandTcl_SetUnicodeObjfopenZvfs_MountTcl_ThreadAlertTcl_BadChannelOptionTclpSetVariablesTcl_PkgPresentEx_tr_initTcl_AppendToObjgzwriteTclInitNamespaceSubsystemTclSockGetPorttclArraySearchTypeTcl_FSGetTranslatedStringPathTclUniCharMatchTcl_ExprLongObjTclFindCompiledLocaltclForeachInfoTypeCrapvfs_SafeInitstrtoullTclCheckExecutionTracesTcl_FileObjCmdTcl_GetDoubleFromObjTcl_UniCharIsAlnumTclGetExtensionTcl_ServiceEventTcl_ChannelWideSeekProcTcl_ParseQuotedStringgetsockoptTcl_GetIndexFromObjStructTcl_OpenObjCmdTclX_DownShiftTcl_SignalIdTclObjInterpProcTclHandleReleaseTclSetLibraryPathgetgrgidrc4_free_repTcl_PrintDoubleTcl_GetAllocMutexTcl_RegExpExecTclTraceExecutionObjCmdTclCheckInterpTracesTcl_ImportTcl_UniCharToLowerTcl_OpenTcpServergzungetcTclCompileLindexCmdTcl_UntraceVarTcl_WaitForEvent.st_double_foreffTclX_IsNullObjTcl_JoinThreadTclTransferResultTclFreeJumpFixupArraytimezonelzmaEndTclCompileAppendCmdTcl_StringObjCmdTcl_IsSafeTcl_OpenTcpClient.st_doubleTcl_RecordAndEvalObjTcl_ChannelThreadActionProc_environTcl_FSJoinPathlistenzlibCompileFlagsTcl_ConditionWaitTcl_ChannelNameTclFinalizeCompilationTclpObjNormalizePathTcl_MainTclX_RestoreResultErrorInfoTcl_PkgProvideTcl_UtfToUpperTcl_UngetsTcl_DStringAppendElementTcl_FSNewNativePathTclRememberMutexTcl_FblockedObjCmdTclReExecTcl_UpVaratanTcl_DbCkallocTcl_GetCommandFullNameTcl_HashStatsTcl_SetAssocDataTclProcInterpProc__xargvTcl_ExprObjTcl_BreakObjCmdTcl_SetByteArrayObjTcl_UnstackChannelTcl_PosixErrorTcl_EvalFileTcl_FSCopyDirectorymkdirfdopenTcl_AsyncInvokeTclTraceVariableObjCmdTcl_DbNewStringObjsendTcl_ArrayObjCmdTclpGetUserHomeTclpStrftimelstat64Tcl_LoadObjCmdTcl_AlloctclXWrongArgsTclCompileVariableCmdTcl_GetChannelInstanceDataTcl_CatchObjCmdTclDatecharTcl_ConditionFinalizermdirTcl_DetachPidsTclpObjListVolumesTclChannelTransform_lib_versiontclObjHashKeyTypeTcl_DeleteTimerHandlersetuidTcl_GetUniCharTcl_VarTraceInfofcloseTcl_EventuallyFreeTclpLoadFile__xargcTcl_GetRangetclDefaultEncodingDirTclCompileExprCmdtclStringTypeTcl_NewBooleanObjTcl_EvalsscanfgetegidTclPrecTraceProcTcl_GetChannelTypeTcl_VwaitObjCmdTcl_DeleteCommanddeflateParamsTcl_AppendResultVATclGetOriginalCommandTcl_AllocStatBufTcl_ExprStringchmodTcl_IsChannelRegisteredTclFSNormalizeToUniquePathtolowerTcl_AppendObjCmdTclDeleteLiteralTableTclpGetPwUidTcl_PopCallFrameTcl_AttemptDbCkrealloctclIntTypeinflateCopyTcl_TraceObjCmdTcl_GetRegExpFromObjclosedirTcl_UtfCharCompleteTclHandleFreeTclRegExpRangeUniCharTcl_ListObjReplaceCrapvfs_UnmountTcl_FconfigureObjCmdTcl_SetObjResultTcl_SetCommandInfoTcl_CreateChannelHandlerTclFileCopyCmdTcl_ReadRawTclpHasSocketsdeflateTcl_RegisterObjTypeTcl_SetListObjrc4_string_repTcl_PutEnvTclInExitTcl_LogCommandInfoTcl_UtfToUniCharDStringTcl_RestoreResultTcl_GetMastermknodTcl_AddObjErrorInfoTcl_TellOldTcl_FSStatTclpMakeFileTclOpenFileChannelDeleteProcTcl_FindHashEntryTclUnixWaitForFileTcl_CreateCommandTcl_TellseekdirTcl_FindCommandTcl_ExposeCommandTcl_FSJoinToPathTcl_Getscfsetospeeddup2Tcl_UntraceCommandatexitTcl_GetChannelOptiongztell__iobselectTcl_LsetObjCmdTcl_AppendAllObjTypesTclFSMakePathRelativegetcwdTcl_TraceCommandTcl_VarEvalVAZvfs_UnmountTclInitObjSubsystemTcl_DStringEndSublistTcl_SourceRCFileTclGlobalInvokeTclCompileExprWordsTcl_Closeopendirgmtime_rTcl_EncodingObjCmdTcl_GetStringResultTclFileRenameCmdTcl_ForObjCmdTcl_ParseVarsignalTclPtrGetVarTclGlobgzrewindTcl_SetTimerTclX_RelativeExprTcl_ChannelClose2ProcTclpGetTimeTcl_SetErrorCodeTclHandlePreservedlerrorTcl_FSCreateDirectoryTcl_GetNamespaceResolversTclX_StrToIntreadlinkgetppidTclObjInvoke_tr_flush_blockTcl_ExprObjCmdTclDumpMemoryInfoTclFindProcTclExprFloatErrorTclpAllocTcl_SetMaxBlockTimeTclIsLocalScalarTcl_GetAliasObjTclpGetNativePathTypeTcl_SplitPathTclCompileScriptTcl_MakeFileChannel_starttclEmptyStringRepTcl_ChannelSeekProcTcl_CreateFileHandlergzdirectTcl_PutsObjCmdTclGetInstructionTable_GLOBAL_OFFSET_TABLE_TclProcDeleteProcTclInitNotifierinet_ntoaTcl_RegExpCompileTcl_FSUnregisterTcl_CreateAliasTcl_AsyncMarktclDoubleTypeTclInterpReadyTcl_EvalTokensTcl_GetOpenFileTcl_GetChannelThreadTcl_ReadObjCmdTcl_AppendResultunlinkTclDatenerrsTcl_AppendElementTclLookupLiteralEntrystrstrTcl_RegsubObjCmdTclpInitLockz_errmsgTcl_ListObjAppendListTclpInitLibraryPathstrtoll.st_intInstallkit_ZlibCmdTcl_FSRegisterTcl_GlobalEvalObjdeflatePrimegzclearerrTclpFinalizePipestclBuiltinFuncTableTcl_FSGetCwdTcl_ExternalToUtfDStringTcl_ObjGetVar2.ld_intTclCompileStringCmdTcl_NewWideIntObjgzopenTcl_AttemptReallocTcl_DStringFreeTcl_SetSystemEncodingstrrchrTclX_GetUnsignedFromObjTcl_NotifyChannelchdirTcl_CloseObjCmdTcl_ServiceModeHookTclCompileCatchCmdTclGetEncodingFromObjTcl_ReleaseTclDeleteNamespaceVarsTclLindexFlatTcl_GetChannelModeTclpNativeJoinPathTcl_SeekObjCmdTclGetEnvTcl_InvalidateStringRepTclObjUnsetVar2Tcl_ObjSetVar2__1cG__CrunMdo_exit_code6F_v_fflushTcl_CreateTrace_dist_codeTclIsProctclIntStubsPtrTclPtrIncrVardeflateEndTcl_CreateObjCommandTcl_ServiceAllTclFileAttrsCmdTclParseBackslashTclExpandCodeArrayTcl_ForeachObjCmdTcl_UtfNcasecmpTcl_AppendStringsToObjVATcl_LappendObjCmdTclGetAndDetachPidsTclInitLiteralTableTclGetLoadedPackagesTcl_AsyncCreateTcl_UnsetVar2Tcl_GetVariableFullNamepipeTcl_UniCharIsAlphaTclInitIOSubsystemTcl_GetServiceModeTclX_GetChannelOptionTcl_WriteCharsTclGuessPackageNameTcl_ChannelHandlerProcTcl_DiscardResultTclGetLibraryPathTcl_SubstObjTcl_TraceVarsetgidTcl_UniCharToUtfDStringTcl_ExternalToUtfTcl_DbNewBooleanObjTcl_NewLongObjTcl_DeleteChannelHandler_tr_stored_blockTcl_RegexpObjCmdTclLindexListTcl_GetTimeTclCompileIfCmdTcl_GetsObjTcl_GetCurrentNamespaceTclpGmtime_unixTcl_FSChdirTcl_GetChannelHandleTcl_SetWideIntObjTcl_ErrorObjCmdTcl_DbNewListObjreaddir64Tcl_GetBooleanfcntlTcl_GetChannelNameTcl_MergeTcl_GetChannelBufferSizeTcl_SetChannelOptionTcl_GetSlaveTcl_ChannelVersionTclStatDeleteProcTcl_LlengthObjCmdTclpInitUnlockfprintfTclpObjCopyDirectoryTclFileDeleteCmdtclOriginalNotifierTclpDeleteFileTclInitJumpFixupArrayfloorTclDeleteExecEnvTclCompileTokensTcl_TranslateFileNameSHA1InitstrtoulTcl_DeleteHashEntryTcl_CaseObjCmdTcl_GetCommandFromObjexeclTcl_HideCommandTcl_FinalizeThreadTcl_ListObjIndexTcl_AfterObjCmdTcl_ErrnoIdTcl_JoinObjCmdTcl_UniCharToUtfinflate_fastTcl_ListObjGetElementsTcl_SetObjErrorCodeTcl_SetStringObjTcl_GetDefaultEncodingDirTclFileMakeDirsCmdinflate_tableTclNewProcBodyObjTcl_ReadCharsTcl_DoWhenIdleTclSetupEnvisattyTclpCheckStackSpaceTcl_UtfFindFirstTclCleanupByteCodememcmpTclpGetGrNamTclInterpInitTcl_EofTcl_DStringInitTcl_StackChannelbind_tr_alignTclFinalizeFilesystemsprintfTcl_SetNamespaceResolversTcl_IfObjCmdTcl_GetTopChannelTcl_GlobObjCmdinflateTcl_GetEncodingNamesTclpLocaltime_unixTcl_DStringAppendstrtodTcl_NewDoubleObjTcl_SpliceChannelTcl_DontCallWhenDeletedTcl_GetCommandNametclpFileAttrProcsTclInitCompiledLocalsTcl_FSDeleteFileTcl_DbNewLongObjatoiTclFinalizeLockTcl_ForgetImportstrtolTclVarTraceExistsTcl_PkgPresentTcl_ConvertToTypesymlinkTclpGetTimeZoneTclStatInsertProctclArrayHashKeyTypeTcl_FSAccessTclpObjRemoveDirectoryadler32_combineTcl_FSGetFileSystemForPathTcl_StringMatchTcl_ChannelOutputProcTclCreatePipelineTclGetStartupScriptPathTcl_GetIndexFromObjTclHideUnsafeCommandstclOneWordHashKeyTypelzmaDecodeTcl_ExprDoubleTcl_VarTraceInfo2TclpUtimeTclCompileIncrCmdTcl_GetChannelTclArraySettclBooleanTypetclPlatStubsdlopentzsetTcl_WriteTcl_ChannelGetHandleProcTcl_UnlinkVarmemcpyTcl_UntraceVar2TclLsetFlatTclpOpenFileChannelTclCompileForCmdlseek64crc32TclEmitForwardJumpTclDatelvalTcl_ChannelBufferedTcl_UtfAtIndexTclRememberDataKeyTcl_GetStdChannelTclEvalObjvInternalTcl_OpenCommandChannelfputcTclpFreeTcl_PanicInstallkit_StartupTcl_NewListObjTcl_CreateNamespaceTcl_SaveResultTclRegAboutTcl_NewIntObjTclCreateExecEnvTclThreadDataKeyGetsetpgidTcl_UtfPrevTcl_InitMemoryTcl_SetObjLength_edataTcl_NewObjTcl_UniCharAtIndextclPlatformTclpDlopenTclCleanupCommandTcl_WriteObjTclThreadDataKeySetTcl_ChannelBlockModeProcTclCompileReturnCmdTcl_GetStringTcl_DStringResultTclpReaddir___ArgvTcl_CutChannelTclpObjRenameFileTcl_GetErrnodeflateTuneTcl_FSLstatTclX_StructOffsetTcl_InitCustomHashTableTcl_GetIntFromObjTcl_ExportTclNewFSPathObjTcl_SeekOldTcl_NumUtfCharsTcl_FSMountsChangedTclLookupVarTcl_SetVarTclpObjDeleteFilelog10Tcl_SubstObjCmdmemmoveTclAllocateFreeObjectsTcl_UniCharNcasecmpTclPrintSourceTcl_ClockObjCmdfabsforkTcl_LindexObjCmdTcl_CommandTraceInfoTcl_FreeResultTclDatedebugtcgetattrTclCopyAndCollapsepowmkstempTclX_CreateObjCommandTcl_SetPanicProcTcl_FindExecutableTcl_ListObjLengthTcl_DbNewObjTcl_ExprDoubleObjTcl_RegisterChannelinet_addrTcl_UtfFindLastTcl_UtfNextTcl_PkgRequireExTclFileDirnameTclReFreememsetTclListObjSetElementTclCompileRegexpCmdTcl_UniCharIsPrintTclAccessDeleteProcTclReCompTclFormatInttcsetattrTcl_SetChannelBufferSizeTcl_UniCharIsGraphTclpCreateTempFileTclFinalizeThreadDataTcl_StringCaseMatchstrncasecmpgetpwnamTcl_InitObjHashTablegetenvTclGetFrameTcl_BackgroundErrorTcl_FSGetNativePathTcl_CreateEventSourceTcl_ErrnoMsgTcl_DuplicateObjTcl_BinaryObjCmdTclFinalizeExecutionTcl_ContinueObjCmdTcl_FSEvalFileTcl_StaticPackageTcl_IsStandardChanneltanhTcl_ConcatObjCmdtclStubsTclSetStartupScriptFileNamestrerrorsetlocaleTcl_Initlocaltime_rTclpCreatePipeTcl_UpdateObjCmdTcl_FSSplitPathTcl_ThreadQueueEventTcl_TellObjCmdTcl_GetHostNameTcl_CreateEncodingTcl_LrangeObjCmdTcl_MutexUnlockTcl_AttemptSetObjLengthstrncat__cg92_used ./generic/crapvfs.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o crapvfs.o ./generic/crapvfs.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 ./generic/miniarc.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o miniarc.o ./generic/miniarc.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.824./generic/sha1.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o sha1.o ./generic/sha1.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8d(N./generic/LZMADecode.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o LZMADecode.o ./generic/LZMADecode.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8(h./generic/installkit.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o installkit.o ./generic/installkit.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8./generic/main.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o main.o ./generic/main.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8./generic/zlib.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o zlib.o ./generic/zlib.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8,./generic/zvfs.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o zvfs.o ./generic/zvfs.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8[$./generic/tclXcmds.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o tclXcmds.o ./generic/tclXcmds.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8$./generic/tclXutil.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o tclXutil.o ./generic/tclXutil.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8$./unix/tclXunixId.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o tclXunixId.o ./unix/tclXunixId.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8$./unix/tclXunixOS.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/installkit /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -O -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -I./generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/win -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/include -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/src/zip -o tclXunixOS.o ./unix/tclXunixOS.cXa;O;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8"@8/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclBasic.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclBasic.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8TDR/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclBinary.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclBinary.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8Dl/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCkalloc.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCkalloc.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8/@/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclClock.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclClock.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8@/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCmdAH.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCmdAH.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 @/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCmdIL.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCmdIL.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8x@/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCmdMZ.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCmdMZ.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8H/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCompCmds.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCompCmds.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8RD/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCompile.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclCompile.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8@"/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclDate.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclDate.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.81H</devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclEncoding.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclEncoding.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8<V/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclEnv.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclEnv.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 @p/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclEvent.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclEvent.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8xD/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclExecute.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclExecute.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8@/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclFCmd.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclFCmd.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8TH/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclFileName.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclFileName.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8</devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclGet.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclGet.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 0@/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclHash.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclHash.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 H /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIndexObj.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIndexObj.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 D&/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclInterp.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclInterp.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 w<@/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIO.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIO.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 @Z/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIOCmd.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIOCmd.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 ODt/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIOSock.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIOSock.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 D/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIOUtil.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclIOUtil.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 *D/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclListObj.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclListObj.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 D/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclLiteral.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclLiteral.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 @/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclLoad.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclLoad.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 v@/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclMain.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclMain.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8 D/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclNamesp.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1' -DHAVE_SYS_PARAM_H='1' -DSTATIC_BUILD='1' -D_REENTRANT='1' -D_POSIX_PTHREAD_SEMANTICS='1' -DTCL_WIDE_INT_TYPE='long long' -DHAVE_STRUCT_DIRENT64='1' -DHAVE_STRUCT_STAT64='1' -DHAVE_OPEN64='1' -DHAVE_LSEEK64='1' -DHAVE_TYPE_OFF64_T='1' -DWORDS_BIGENDIAN='1' -DHAVE_GETCWD='1' -DHAVE_OPENDIR='1' -DHAVE_STRSTR='1' -DHAVE_STRTOL='1' -DHAVE_STRTOLL='1' -DHAVE_STRTOULL='1' -DHAVE_TMPNAM='1' -DHAVE_WAITPID='1' -DUSE_TERMIOS='1' -DHAVE_SYS_TIME_H='1' -DTIME_WITH_SYS_TIME='1' -DHAVE_TZNAME='1' -DHAVE_GMTIME_R='1' -DHAVE_LOCALTIME_R='1' -DHAVE_TIMEZONE_VAR='1' -DHAVE_STRUCT_STAT_ST_BLKSIZE='1' -DHAVE_ST_BLKSIZE='1' -DNO_UNION_WAIT='1' -DHAVE_SIGNED_CHAR='1' -DHAVE_LANGINFO='1' -DHAVE_SYS_IOCTL_H='1' -DHAVE_SYS_FILIO_H='1' -DTCL_SHLIB_EXT='".so"' /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclNamesp.cXa;O;P;R=Sun C 5.8 2005/10/13;backend;raw;cd;DBG_GEN 5.0.8ND*/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic/tclNotify.c /devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/Solaris-SUNS/build/tcl /devl/apps.norge/sunstudio11/SUNWspro/prod/bin/cc -c -O -DTCL_DBGX='' -KPIC -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix/../generic -I/devl/scratch/ogr/InstallKit_1.2.10_SOLARIS/src/tcl/unix -DPACKAGE_NAME='""' -DPACKAGE_TARNAME='""' -DPACKAGE_VERSION='""' -DPACKAGE_STRING='""' -DPACKAGE_BUGREPORT='""' -DSTDC_HEADERS='1' -DHAVE_SYS_TYPES_H='1' -DHAVE_SYS_STAT_H='1' -DHAVE_STDLIB_H='1' -DHAVE_STRING_H='1' -DHAVE_MEMORY_H='1' -DHAVE_STRINGS_H='1' -DHAVE_INTTYPES_H='1' -DHAVE_UNISTD_H='1' -DHAVE_LIMITS_H='1' -DHAVE_UNISTD_H='1